Diaphorina citri psyllid: psy12288


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MLFDQQESYMEYRPGGYCPVQIGDLFNFRYHVIRKLGWGHFSTVWLSWDLQDKTFVALKIVKSDQVYADTARDEIVLLKAVGRKSNVHSSAYNTQASEKVIRLLNDFKIYSRNGTHICMVFEVMGYNLLRLIARSDYKGIHIQNVRTIIKQVLEGLNYLHTQCRIIHTDIKPENILMCVDYDKVRRMARDATKHHKIGMKLPMSLDSTMSDFSLLDPANEVYDISVKIADLGNACWIDDHFADEIQTRQYRSVEVLIGAGYGPAADIWSTACMAFELATGDYLFDPKAGKEYSRDDDHLAHIVELVGPIPKEVLSQGKKTLRYFTPQGNFRRIDNLKPWGLYQVLTEKYHWSKAEASDFADFLLPMLHVNQKLRASAADCLRHPWLNPRRSHY
ccccccccccccccccCEEEccccCEcccEEEEEEEEccccEEEEEEEEcccccEEEEEEEEcccccHHcHHHHHHHHHHHHccccccccccccccccccEEEcccEEEEcccccEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEccccEEcccccccccccccccccEEEEcccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHccccccccccccHHHHHcccccccccccc
MLFDQQESYMEYRPGGYCPVQIGDLFNFRYHVIRKLGWGHFSTVWLSWDLQDKTFVALKIVKSDQVYADTARDEIVLLKAVGRKSNVHSSAYNTQASEKVIRLLNDFKIYSRNGTHICMVFEVMGYNLLRLIARSDYKGIHIQNVRTIIKQVLEGLNYLHTQCRIIHTDIKPENILMCVDYDKVRRMARDAT*******KLPMSLDSTMSDFSLLDPANEVYDISVKIADLGNACWIDDHFADEIQTRQYRSVEVLIGAGYGPAADIWSTACMAFELATGDYLFDPKAGKEYSRDDDHLAHIVELVGPIPKEVLSQGKKTLRYFTPQGNFRRIDNLKPWGLYQVLTEKYHWSKAEASDFADFLLPMLHVNQKLRASAADCLRHPWLNP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFDQQESYMEYRPGGYCPVQIGDLFNFRYHVIRKLGWGHFSTVWLSWDLQDKTFVALKIVKSDQVYADTARDEIVLLKAVGRKSNVHSSAYNTQASEKVIRLLNDFKIYSRNGTHICMVFEVMGYNLLRLIARSDYKGIHIQNVRTIIKQVLEGLNYLHTQCRIIHTDIKPENILMCVDYDKVRRMARDATKHHKIGMKLPMSLDSTMSDFSLLDPANEVYDISVKIADLGNACWIDDHFADEIQTRQYRSVEVLIGAGYGPAADIWSTACMAFELATGDYLFDPKAGKEYSRDDDHLAHIVELVGPIPKEVLSQGKKTLRYFTPQGNFRRIDNLKPWGLYQVLTEKYHWSKAEASDFADFLLPMLHVNQKLRASAADCLRHPWLNPRRSHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase spk-1 Required for embryogenesis and germline development in both adult hermaphrodites and males. SR-protein kinase (SRPK) that binds directly to and phosphorylates the RS domain of rsp-3/CeSF2 in vitro.confidentQ03563
Probable serine/threonine-protein kinase sky1 confidentQ86A12
SRSF protein kinase 1 Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. Plays a central role in the regulatory network for splicing, controlling the intranuclear distribution of splicing factors in interphase cells and the reorganization of nuclear speckles during mitosis. Can influence additional steps of mRNA maturation, as well as other cellular activities, such as chromatin reorganization in somatic and sperm cells and cell cycle progression. Phosphorylates SFRS2, ZRSR2, LBR and PRM1. Phosphorylates SRSF1 using a directional (C-terminal to N-terminal) and a dual-track mechanism incorporating both processive phosphorylation (in which the kinase stays attached to the substrate after each round of phosphorylation) and distributive phosphorylation steps (in which the kinase and substrate dissociate after each phosphorylation event). The RS domain of SRSF1 binds first to a docking groove in the large lobe of the kinase domain of SRPK1. This induces certain structural changes in SRPK1 and/or RRM2 domain of SRSF1, allowing RRM2 to bind the kinase and initiate phosphorylation. The cycles continue for several phosphorylation steps in a processive manner (steps 1-8) until the last few phosphorylation steps (approximately steps 9-12). During that time, a mechanical stress induces the unfolding of the beta-4 motif in RRM2, which then docks at the docking groove of SRPK1. This also signals RRM2 to begin to dissociate, which facilitates SRSF1 dissociation after phosphorylation is completed. Can mediate hepatitis B virus (HBV) core protein phosphorylation. It plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reducing the packaging efficiency of the pregenomic RNA (pgRNA) without affecting the formation of the viral core particles. Can induce splicing of exon 10 in MAPT/TAU.confidentQ5RD27

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043525 [BP]positive regulation of neuron apoptotic processprobableGO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0000245 [BP]spliceosomal complex assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0007059 [BP]chromosome segregationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0045071 [BP]negative regulation of viral genome replicationprobableGO:2000242, GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048525, GO:0048519, GO:0050789, GO:0048523
GO:0071889 [MF]14-3-3 protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007276 [BP]gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048786 [CC]presynaptic active zoneprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0007519 [BP]skeletal muscle tissue developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0050684 [BP]regulation of mRNA processingprobableGO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0045070 [BP]positive regulation of viral genome replicationprobableGO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0043902, GO:0043900, GO:0065007, GO:0008150, GO:2000243, GO:0048518, GO:0048524, GO:0050789, GO:0048522
GO:0035063 [BP]nuclear speck organizationprobableGO:0006996, GO:0006997, GO:0009987, GO:0030575, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q8Y, chain A
Confidence level:very confident
Coverage over the Query: 17-183,221-390
View the alignment between query and template
View the model in PyMOL
Template: 1WAK, chain A
Confidence level:very confident
Coverage over the Query: 13-193,208-388
View the alignment between query and template
View the model in PyMOL