Diaphorina citri psyllid: psy12291


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
WIKSDKEDSWYRCCEGPCRCRPEIHTLSCWKQDMEELPFDQIIPVDIRVIDLGINQLSTLSKDAFTGLYKLTELKLRKNHLSELPGKLFISTINLSTMDLSQNLIKTLPSTFFKGAIRLTVVQLSYNAIESLPANVFHDLISLEELDLSQNVLTSIQYGTFSGMYSLKRLKLQSNRINQLPPGIFDDLKYLDFLSLRNNRLSFIRPGLFNYFKHLTFLELSENWISSLNGDEFSQLTSLKELHLGQNYIETIPAGSFANLQSLEKLFLYSNNIQELHAGTFAGLTNLTALFLNNNLLRYLDTKAFEPMLHLKKLQLDSNKLQYLATDSLSLLPNLITLKLAKNPWHCDCAILYMARWLRANRRKVWDSKPTCRGPGNLGGKSVEDMSFDDLCEGQWASMVKLTA
cccccccccccccccccccccccccEEEEcccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHHHHHHHcccccccccECcccccccccccccccccccccccccccccccc
********SWYRCCEGPCRCRPEIHTLSCWKQDMEELPFDQIIPVDIRVIDLGINQLSTLSKDAFTGLYKLTELKLRKNHLSELPGKLFISTINLSTMDLSQNLIKTLPSTFFKGAIRLTVVQLSYNAIESLPANVFHDLISLEELDLSQNVLTSIQYGTFSGMYSLKRLKLQSNRINQLPPGIFDDLKYLDFLSLRNNRLSFIRPGLFNYFKHLTFLELSENWISSLNGDEFSQLTSLKELHLGQNYIETIPAGSFANLQSLEKLFLYSNNIQELHAGTFAGLTNLTALFLNNNLLRYLDTKAFEPMLHLKKLQLDSNKLQYLATDSLSLLPNLITLKLAKNPWHCDCAILYMARWLRANRRKVWDSKPTCRGPGNLGGKSVEDMSFDDLCEGQWASMVK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WIKSDKEDSWYRCCEGPCRCRPEIHTLSCWKQDMEELPFDQIIPVDIRVIDLGINQLSTLSKDAFTGLYKLTELKLRKNHLSELPGKLFISTINLSTMDLSQNLIKTLPSTFFKGAIRLTVVQLSYNAIESLPANVFHDLISLEELDLSQNVLTSIQYGTFSGMYSLKRLKLQSNRINQLPPGIFDDLKYLDFLSLRNNRLSFIRPGLFNYFKHLTFLELSENWISSLNGDEFSQLTSLKELHLGQNYIETIPAGSFANLQSLEKLFLYSNNIQELHAGTFAGLTNLTALFLNNNLLRYLDTKAFEPMLHLKKLQLDSNKLQYLATDSLSLLPNLITLKLAKNPWHCDCAILYMARWLRANRRKVWDSKPTCRGPGNLGGKSVEDMSFDDLCEGQWASMVKLTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat-containing protein 15 confidentQ80X72

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0032501 [BP]multicellular organismal processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 22-347
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 27-386
View the alignment between query and template
View the model in PyMOL
Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 1-326
View the alignment between query and template
View the model in PyMOL
Template: 2XOT, chain A
Confidence level:very confident
Coverage over the Query: 168-402
View the alignment between query and template
View the model in PyMOL