Diaphorina citri psyllid: psy12307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MGHSSDMYLECPPAEDGMERFACPTPDHMGRYRCIDDHVLCDGFIDCPTGEDEDRQNFLLENELCWGLSIYKALDKSTGLRSILNWSDLVNLGLRIKWQGLESIRV
ccccccEEEEcccccccccEECcccccccccEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHHccccccHHHccHHHHHccccEEEEccccEEcc
****SDM**ECPPAEDGMERFACPTPDHMGRYRCIDDHVLCDGFIDCPTGEDEDRQNFLLENELCWGLSIYKALDKSTGLRSILNWSDLVNLGLRIKWQGLESIR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHSSDMYLECPPAEDGMERFACPTPDHMGRYRCIDDHVLCDGFIDCPTGEDEDRQNFLLENELCWGLSIYKALDKSTGLRSILNWSDLVNLGLRIKWQGLESIRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007522 [BP]visceral muscle developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0007435 [BP]salivary gland morphogenesisprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0042051 [BP]compound eye photoreceptor developmentprobableGO:0048749, GO:0044707, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0042462, GO:0042461, GO:0048869, GO:0048513, GO:0048666, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001745, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XRC, chain A
Confidence level:confident
Coverage over the Query: 8-57
View the alignment between query and template
View the model in PyMOL