Diaphorina citri psyllid: psy12310

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MDLVNVNTNSKSLDALTSTNQALIPTRKSGKPAQPHQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPLPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD
ccEEEcccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEccccccccEEEEEEccccccccccccccEEEEEccCCcccccHHHHHHHHHHcccCEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccc
**************************************TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLG**********************************************************************L*****E******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLVNVNTNSKSLDALTSTNQALIPTRKSGKPAQPHQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPLPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GSL, chain A
Confidence level:very confident
Coverage over the Query: 37-125
View the alignment between query and template
View the model in PyMOL
Template: 3K50, chain A
Confidence level:confident
Coverage over the Query: 51-198
View the alignment between query and template
View the model in PyMOL