Psyllid ID: psy12310


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MDLVNVNTNSKSLDALTSTNQALIPTRKSGKPAQPHQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPLPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD
ccEEEcccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEccccccccEEEEEEccccccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccc
ccEEEEccccccHHHcccccccccccccccccccccccEEEEEEEccccccccEEEEEccccccccEEEEEEccccHHHcccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccc
mdlvnvntnsksldaltstnqaliptrksgkpaqphqntftvvikrpnrhhswglriaggcdldspivitkvypgtpaaaelkRGDIIRkigdydsrdlrhkdatnffqssdtsislgiqrnppgekkaasgsrsvtplpivdycqkeskassasMSVVNSFHDFLDHQHVHraqavaspfelssehdlnyvikeqlgpkd
MDLVNVNtnsksldalTSTNQALIptrksgkpaqphqNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPgtpaaaelkrgdiiRKIGDYDSRDLRHKDAtnffqssdtsislgiqrnppgekkaasgsrsvtplPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPfelssehdlnyvikeqlgpkd
MDLVNVNTNSKSLDALTSTNQALIPTRKSGKPAQPHQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPLPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD
**************************************TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYD*********************************************IVDY**************VNSFHDFLDHQHVHRAQAVA**********LNYV*********
*****************************************VVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLG****************************************************************************E******
********NSKSLDALTSTNQALIPT*********HQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQR*************SVTPLPIVDYCQK*********SVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD
*DLVNVNTN*KS***L****QA*************HQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPG***************************************************************L************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLVNVNTNSKSLDALTSTNQALIPTRKSGKPAQPHQNTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPLPIVDYCQKESKASSASMSVVNSFHDFLDHQHVHRAQAVASPFELSSEHDLNYVIKEQLGPKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
Q6QGC0 365 PDZ and LIM domain protei yes N/A 0.343 0.189 0.371 5e-08
Q9PU47 315 PDZ and LIM domain protei yes N/A 0.343 0.219 0.371 6e-08
Q66HS7 362 PDZ and LIM domain protei yes N/A 0.343 0.190 0.371 6e-08
O70209 316 PDZ and LIM domain protei yes N/A 0.343 0.218 0.371 7e-08
Q53GG5 364 PDZ and LIM domain protei no N/A 0.393 0.217 0.349 7e-08
Q3SYZ8 316 PDZ and LIM domain protei yes N/A 0.343 0.218 0.371 8e-08
A1ZA47 2194 PDZ and LIM domain protei no N/A 0.671 0.061 0.294 1e-07
O75112 727 LIM domain-binding protei no N/A 0.512 0.141 0.271 2e-07
Q3T0C8 348 PDZ and LIM domain protei no N/A 0.432 0.25 0.352 5e-07
Q9JKS4 723 LIM domain-binding protei no N/A 0.402 0.112 0.294 5e-07
>sp|Q6QGC0|PDLI3_PIG PDZ and LIM domain protein 3 OS=Sus scrofa GN=PDLIM3 PE=2 SV=1 Back     alignment and function desciption
 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 53  WGLRIAGGCDLDSPIVITKVYPGT-PAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSS 111
           WG R++GG D + P++IT++ PG+  AAA L  GD+I  I  Y +  + H DA +  +++
Sbjct: 13  WGFRLSGGIDFNQPLIITRITPGSKAAAANLCPGDVILAIDGYGTESMTHADAQDRIKAA 72

Query: 112 DTSISLGIQR 121
              + L I R
Sbjct: 73  AHQLCLKIDR 82




May play a role in the organization of actin filament arrays within muscle cells.
Sus scrofa (taxid: 9823)
>sp|Q9PU47|PDLI3_CHICK PDZ and LIM domain protein 3 OS=Gallus gallus GN=PDLIM3 PE=1 SV=1 Back     alignment and function description
>sp|Q66HS7|PDLI3_RAT PDZ and LIM domain protein 3 OS=Rattus norvegicus GN=Pdlim3 PE=1 SV=2 Back     alignment and function description
>sp|O70209|PDLI3_MOUSE PDZ and LIM domain protein 3 OS=Mus musculus GN=Pdlim3 PE=1 SV=1 Back     alignment and function description
>sp|Q53GG5|PDLI3_HUMAN PDZ and LIM domain protein 3 OS=Homo sapiens GN=PDLIM3 PE=1 SV=1 Back     alignment and function description
>sp|Q3SYZ8|PDLI3_BOVIN PDZ and LIM domain protein 3 OS=Bos taurus GN=PDLIM3 PE=2 SV=1 Back     alignment and function description
>sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 Back     alignment and function description
>sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 Back     alignment and function description
>sp|Q3T0C8|PDLI2_BOVIN PDZ and LIM domain protein 2 OS=Bos taurus GN=PDLIM2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
357610215220 hypothetical protein KGM_20121 [Danaus p 0.487 0.445 0.52 1e-21
32870952593 PREDICTED: PDZ and LIM domain protein Za 0.417 0.903 0.535 1e-19
195326079 429 GM25076 [Drosophila sechellia] gi|194118 0.512 0.240 0.458 2e-18
194865828 429 GG14334 [Drosophila erecta] gi|190653407 0.502 0.235 0.448 3e-18
195491117 429 GE20762 [Drosophila yakuba] gi|194179526 0.527 0.247 0.437 3e-18
296531494 315 MIP21713p [Drosophila melanogaster] 0.537 0.342 0.438 4e-18
195588823231 GD14114 [Drosophila simulans] gi|1941961 0.537 0.467 0.438 4e-18
281365866 378 Z band alternatively spliced PDZ-motif p 0.537 0.285 0.438 5e-18
28574408 402 Z band alternatively spliced PDZ-motif p 0.537 0.268 0.438 5e-18
45550577298 Z band alternatively spliced PDZ-motif p 0.537 0.362 0.438 5e-18
>gi|357610215|gb|EHJ66875.1| hypothetical protein KGM_20121 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 2/100 (2%)

Query: 38  NTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAAAELKRGDIIRKIGDYDSR 97
           +TF V ++R +R  +WGLR+ GG DL +P+++T+V PGTPA  EL RGDII KI DYD+R
Sbjct: 2   HTFVVTLRRESRDTNWGLRLVGGSDLATPLIVTRVTPGTPAGKELVRGDIIAKIDDYDAR 61

Query: 98  DLRHKDATNFFQSSDTSISLGIQR--NPPGEKKAASGSRS 135
           DLRH+DA N F+++   I L +QR  N  G   AA   RS
Sbjct: 62  DLRHEDAQNLFRNAPKQIKLAVQRDVNRDGHGSAALAPRS 101




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328709525|ref|XP_003243984.1| PREDICTED: PDZ and LIM domain protein Zasp-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195326079|ref|XP_002029757.1| GM25076 [Drosophila sechellia] gi|194118700|gb|EDW40743.1| GM25076 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194865828|ref|XP_001971624.1| GG14334 [Drosophila erecta] gi|190653407|gb|EDV50650.1| GG14334 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195491117|ref|XP_002093425.1| GE20762 [Drosophila yakuba] gi|194179526|gb|EDW93137.1| GE20762 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|296531494|gb|ADH29882.1| MIP21713p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195588823|ref|XP_002084156.1| GD14114 [Drosophila simulans] gi|194196165|gb|EDX09741.1| GD14114 [Drosophila simulans] Back     alignment and taxonomy information
>gi|281365866|ref|NP_001163382.1| Z band alternatively spliced PDZ-motif protein 66, isoform K [Drosophila melanogaster] gi|115646444|gb|ABJ17060.1| IP16036p [Drosophila melanogaster] gi|272455102|gb|ACZ94653.1| Z band alternatively spliced PDZ-motif protein 66, isoform K [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28574408|ref|NP_729396.2| Z band alternatively spliced PDZ-motif protein 66, isoform F [Drosophila melanogaster] gi|16183154|gb|AAL13644.1| GH19182p [Drosophila melanogaster] gi|28380560|gb|AAN11991.2| Z band alternatively spliced PDZ-motif protein 66, isoform F [Drosophila melanogaster] gi|220945484|gb|ACL85285.1| CG6416-PF [synthetic construct] gi|220955296|gb|ACL90191.1| CG6416-PF [synthetic construct] Back     alignment and taxonomy information
>gi|45550577|ref|NP_648246.3| Z band alternatively spliced PDZ-motif protein 66, isoform B [Drosophila melanogaster] gi|45445990|gb|AAN11992.2| Z band alternatively spliced PDZ-motif protein 66, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
UNIPROTKB|F1PQW6 356 PDLIM2 "Uncharacterized protei 0.487 0.275 0.352 9.7e-09
RGD|1564875 283 Ldb3 "LIM domain binding 3" [R 0.601 0.427 0.261 3.3e-08
UNIPROTKB|F5H0C2 648 LDB3 "LIM domain-binding prote 0.527 0.163 0.279 4.9e-08
UNIPROTKB|O75112 727 LDB3 "LIM domain-binding prote 0.527 0.145 0.279 5.8e-08
UNIPROTKB|G3N3C9 730 LDB3 "Uncharacterized protein" 0.601 0.165 0.261 8.5e-08
FB|FBgn0035917 430 Zasp66 "Z band alternatively s 0.353 0.165 0.441 1.2e-07
FB|FBgn0083919 2194 Zasp52 "Z band alternatively s 0.671 0.061 0.294 1.2e-07
UNIPROTKB|E2QW94 586 LDB3 "Uncharacterized protein" 0.601 0.206 0.261 1.4e-07
UNIPROTKB|D6RAN190 PDLIM7 "PDZ and LIM domain pro 0.437 0.977 0.326 1.6e-07
UNIPROTKB|D4ADB1 684 D4ADB1 "Uncharacterized protei 0.601 0.176 0.261 1.8e-07
UNIPROTKB|F1PQW6 PDLIM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 9.7e-09, P = 9.7e-09
 Identities = 36/102 (35%), Positives = 52/102 (50%)

Query:    39 TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYP-GTPAAAELKRGDIIRKIGDYDSR 97
             T TV +  P     WG RI GG D  SPI++TKV   G   AA+L+ GDII  I    + 
Sbjct:     2 TLTVDVAGPG---PWGFRITGGRDFHSPIMVTKVTERGKAEAADLRPGDIIVAINGESAE 58

Query:    98 DLRHKDATNFFQSSDTSISLGIQRNPPGEKKAASGSRSVTPL 139
              + H +A +  + S + + L + R+P    +  +G  SV  L
Sbjct:    59 GMLHAEAQSKIRHSPSPLRLQLDRSPAASPRQTNGESSVEVL 100




GO:0015629 "actin cytoskeleton" evidence=IEA
GO:0009986 "cell surface" evidence=IEA
GO:0005925 "focal adhesion" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
RGD|1564875 Ldb3 "LIM domain binding 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F5H0C2 LDB3 "LIM domain-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75112 LDB3 "LIM domain-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3C9 LDB3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0035917 Zasp66 "Z band alternatively spliced PDZ-motif protein 66" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0083919 Zasp52 "Z band alternatively spliced PDZ-motif protein 52" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2QW94 LDB3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RAN1 PDLIM7 "PDZ and LIM domain protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4ADB1 D4ADB1 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-15
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-13
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 7e-11
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 1e-07
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-06
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-05
TIGR03900 973 TIGR03900, prc_long_Delta, putative carboxyl-termi 5e-04
pfam1318081 pfam13180, PDZ_2, PDZ domain 0.002
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.003
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.003
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 67.6 bits (166), Expect = 3e-15
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 39  TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAA-AELKRGDIIRKIGDYDSR 97
             TV +++ +     G  + GG D    I +++V PG PA    L+ GD I ++      
Sbjct: 1   VRTVTLRK-DPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVE 59

Query: 98  DLRHKDATNFFQSSDTSISLGIQ 120
            L H++A    ++S   ++L ++
Sbjct: 60  GLTHEEAVELLKNSGDEVTLTVR 82


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.61
KOG3550|consensus207 99.53
KOG3209|consensus984 99.4
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 99.35
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.35
KOG3549|consensus 505 99.34
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.31
KOG3551|consensus 506 99.27
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.25
PLN00049 389 carboxyl-terminal processing protease; Provisional 99.22
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 99.16
KOG3209|consensus 984 99.12
PRK11186 667 carboxy-terminal protease; Provisional 99.12
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.11
KOG3553|consensus124 99.06
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.01
KOG3580|consensus 1027 98.96
KOG3552|consensus 1298 98.81
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.8
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.74
KOG1892|consensus 1629 98.71
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.7
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.63
KOG3542|consensus 1283 98.59
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.56
KOG3580|consensus 1027 98.55
KOG3651|consensus 429 98.53
KOG3606|consensus358 98.51
KOG3571|consensus 626 98.49
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.35
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.29
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.25
PRK10139455 serine endoprotease; Provisional 98.23
PRK10779449 zinc metallopeptidase RseP; Provisional 98.16
PRK10942473 serine endoprotease; Provisional 98.16
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.16
PRK10898353 serine endoprotease; Provisional 98.15
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.11
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.1
PRK10139455 serine endoprotease; Provisional 98.05
PRK10942473 serine endoprotease; Provisional 98.01
KOG3605|consensus829 97.71
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.68
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.62
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.55
KOG0606|consensus 1205 97.51
KOG3129|consensus231 97.49
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.47
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.43
PRK09681276 putative type II secretion protein GspC; Provision 97.42
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.34
KOG0609|consensus 542 97.04
KOG3605|consensus829 96.88
COG3975558 Predicted protease with the C-terminal PDZ domain 96.59
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.53
KOG3532|consensus 1051 96.44
KOG1320|consensus473 96.38
KOG3938|consensus334 96.38
KOG1421|consensus 955 96.22
COG3031275 PulC Type II secretory pathway, component PulC [In 96.19
KOG1738|consensus 638 95.33
smart0073526 ZM ZASP-like motif. Short motif (26 amino acids) p 94.62
KOG1703|consensus 479 94.59
PF1281278 PDZ_1: PDZ-like domain 92.19
KOG4407|consensus 1973 90.84
COG0750 375 Predicted membrane-associated Zn-dependent proteas 88.69
KOG3834|consensus 462 88.63
KOG0792|consensus 1144 87.97
KOG4371|consensus1332 87.63
KOG2921|consensus 484 84.63
KOG4407|consensus 1973 80.45
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
Probab=99.61  E-value=3.4e-15  Score=104.86  Aligned_cols=79  Identities=29%  Similarity=0.570  Sum_probs=72.0

Q ss_pred             EEEEecCCCCceeEEEEEeecCCC-CCcEEEEECCCCcc-ccCCCCCCEEEEECCEECCCCCHHHHHHHHhCCCCeEEEE
Q psy12310         41 TVVIKRPNRHHSWGLRIAGGCDLD-SPIVITKVYPGTPA-AAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISLG  118 (201)
Q Consensus        41 ~V~L~r~~~~~~~Gf~i~gG~~~~-~pi~V~~V~~gspA-~agL~~GD~Il~Ing~~v~~~~~~~av~~ik~~g~~v~L~  118 (201)
                      +|+|.|. ...+|||.+.++.+.. .+++|..|.++||| .+||++||+|++|||.++.++++.+++.+++.++..|+|+
T Consensus         1 ~v~l~k~-~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~gl~~GD~Il~INg~~v~~~~~~~~~~~l~~~~~~v~L~   79 (81)
T PF00595_consen    1 QVTLEKS-GNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAGLKVGDRILEINGQSVRGMSHDEVVQLLKSASNPVTLT   79 (81)
T ss_dssp             EEEEEES-TTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHTSSTTEEEEEETTEESTTSBHHHHHHHHHHSTSEEEEE
T ss_pred             CEEEEeC-CCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcccchhhhhheeCCEeCCCCCHHHHHHHHHCCCCcEEEE
Confidence            4788886 6799999999998853 68999999999999 7889999999999999999999999999999998899998


Q ss_pred             EE
Q psy12310        119 IQ  120 (201)
Q Consensus       119 v~  120 (201)
                      |+
T Consensus        80 V~   81 (81)
T PF00595_consen   80 VQ   81 (81)
T ss_dssp             EE
T ss_pred             EC
Confidence            85



PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....

>KOG3550|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>smart00735 ZM ZASP-like motif Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
1v5l_A103 Solution Structure Of Pdz Domain Of Mouse Alpha-Act 1e-08
1rgw_A85 Solution Structure Of Zasp's Pdz Domain Length = 85 6e-08
1wjl_A90 Solution Structure Of Pdz Domain Of Mouse Cypher Pr 6e-08
2pkt_A91 Crystal Structure Of The Human Clp-36 (Pdlim1) Boun 3e-07
2eeg_A94 Solution Structure Of Pdz Domain Of Pdz And Lim Dom 6e-07
1vb7_A94 Solution Structure Of The Pdz Domain Of Pdz And Lim 8e-07
2q3g_A89 Structure Of The Pdz Domain Of Human Pdlim7 Bound T 9e-07
2v1w_A90 Crystal Structure Of Human Lim Protein Ril (Pdlim4) 1e-06
3pdv_A89 Structure Of The Pdlim2 Pdz Domain In Complex With 2e-05
2uzc_A88 Structure Of Human Pdlim5 In Complex With The C-Ter 2e-05
2pa1_A87 Structure Of The Pdz Domain Of Human Pdlim2 Bound T 2e-05
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 4e-05
1wf7_A103 Solution Structure Of The Pdz Domain Of Enigma Homo 5e-05
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 6e-05
2cs5_A119 Solution Structure Of Pdz Domain Of Protein Tyrosin 6e-05
3nfk_A107 Crystal Structure Of The Ptpn4 Pdz Domain Complexed 6e-05
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 7e-05
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 7e-05
2vph_A100 Crystal Structure Of The Human Protein Tyrosine Pho 5e-04
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 5e-04
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 6e-04
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 7e-04
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 7e-04
>pdb|1V5L|A Chain A, Solution Structure Of Pdz Domain Of Mouse Alpha-Actinin-2 Associated Lim Protein Length = 103 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Query: 53 WGLRIAGGCDLDSPIVITKVYPGT-PAAAELKRGDIIRKIGDYDSRDLRHKDATNFFQSS 111 WG R++GG D + P+VIT++ PG+ AAA L GD+I I + + + H DA + +++ Sbjct: 17 WGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAA 76 Query: 112 DTSISLGIQR 121 + L I R Sbjct: 77 SYQLCLKIDR 86
>pdb|1RGW|A Chain A, Solution Structure Of Zasp's Pdz Domain Length = 85 Back     alignment and structure
>pdb|1WJL|A Chain A, Solution Structure Of Pdz Domain Of Mouse Cypher Protein Length = 90 Back     alignment and structure
>pdb|2PKT|A Chain A, Crystal Structure Of The Human Clp-36 (Pdlim1) Bound To The C-Terminal Peptide Of Human Alpha-Actinin-1 Length = 91 Back     alignment and structure
>pdb|2EEG|A Chain A, Solution Structure Of Pdz Domain Of Pdz And Lim Domain Protein Length = 94 Back     alignment and structure
>pdb|1VB7|A Chain A, Solution Structure Of The Pdz Domain Of Pdz And Lim Domain 2 Length = 94 Back     alignment and structure
>pdb|2Q3G|A Chain A, Structure Of The Pdz Domain Of Human Pdlim7 Bound To A C- Terminal Extension From Human Beta-Tropomyosin Length = 89 Back     alignment and structure
>pdb|2V1W|A Chain A, Crystal Structure Of Human Lim Protein Ril (Pdlim4) Pdz Domain Bound To The C-Terminal Peptide Of Human Alpha- Actinin-1 Length = 90 Back     alignment and structure
>pdb|3PDV|A Chain A, Structure Of The Pdlim2 Pdz Domain In Complex With The C-Terminal 6- Peptide Extension Of Ns1 Length = 89 Back     alignment and structure
>pdb|2UZC|A Chain A, Structure Of Human Pdlim5 In Complex With The C-Terminal Peptide Of Human Alpha-Actinin-1 Length = 88 Back     alignment and structure
>pdb|2PA1|A Chain A, Structure Of The Pdz Domain Of Human Pdlim2 Bound To A C-Terminal Extension From Human Beta-Tropomyosin Length = 87 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|1WF7|A Chain A, Solution Structure Of The Pdz Domain Of Enigma Homologue Protein Length = 103 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2CS5|A Chain A, Solution Structure Of Pdz Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 4 Length = 119 Back     alignment and structure
>pdb|3NFK|A Chain A, Crystal Structure Of The Ptpn4 Pdz Domain Complexed With The C- Terminus Of A Rabies Virus G Protein Length = 107 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|2VPH|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain Length = 100 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-23
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 9e-23
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-22
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-22
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-22
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-22
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-21
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-21
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 4e-21
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-16
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-16
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-16
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-16
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-16
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 7e-16
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-16
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 1e-15
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-15
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-15
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-15
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-15
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 3e-15
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-15
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-15
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 4e-15
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 4e-15
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 5e-15
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-15
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 6e-15
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-12
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-14
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-14
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 3e-14
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-14
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-14
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-14
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-14
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 4e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 6e-14
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 9e-14
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 9e-14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-13
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-10
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-13
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 4e-13
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-13
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-13
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 6e-13
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-13
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 7e-13
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 7e-13
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 9e-13
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-12
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-12
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-10
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-12
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-12
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-12
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-12
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-12
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-12
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-12
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-12
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-12
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 3e-12
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 4e-12
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-12
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 4e-12
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 4e-12
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 5e-12
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-12
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 6e-12
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 7e-12
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 8e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-11
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-11
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-11
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-11
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 2e-11
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-11
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-11
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 3e-11
2eaq_A90 LIM domain only protein 7; conserved hypothetical 3e-11
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 3e-11
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-11
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 4e-11
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 5e-11
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 7e-11
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-11
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 8e-11
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 8e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-10
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-10
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-08
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-10
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-10
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-10
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-10
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 5e-10
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 6e-10
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 8e-10
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-09
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-09
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-09
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 5e-09
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 7e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-08
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 8e-09
3khf_A99 Microtubule-associated serine/threonine-protein ki 9e-09
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-08
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-08
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-08
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-08
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-08
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-08
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-08
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-08
2eei_A106 PDZ domain-containing protein 1; regulatory factor 8e-08
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-07
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-07
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-07
2ego_A96 General receptor for phosphoinositides 1- associat 3e-07
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 4e-07
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 5e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 5e-07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 8e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 8e-07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 9e-07
2v90_A96 PDZ domain-containing protein 3; membrane, protein 9e-07
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-06
3k50_A 403 Putative S41 protease; structural genomics, joint 1e-06
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-06
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-06
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 5e-06
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 7e-06
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 7e-06
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 9e-06
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-05
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 1e-05
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 2e-05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-05
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-05
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-04
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 8e-05
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 9e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 1e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-04
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 1e-04
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 4e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 2e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 7e-04
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 2e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 7e-04
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 2e-04
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 3e-04
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 4e-04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 4e-04
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 4e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 6e-04
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
 Score = 87.0 bits (216), Expect = 6e-23
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 38  NTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAA-AELKRGDIIRKIGDYDS 96
           ++F VV++ P     WG R+ GG D + P+ I+++ PG  AA A +  GD +  I   ++
Sbjct: 3   DSFKVVLEGPA---PWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENA 59

Query: 97  RDLRHKDATNFFQSSDTSISLGIQRNPPG 125
             L H +A N  ++    +SLG+ R    
Sbjct: 60  GSLTHIEAQNKIRACGERLSLGLSRAITS 88


>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.69
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.69
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.69
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.68
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.68
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.67
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.67
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.67
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.67
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.67
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.67
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.67
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.67
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.66
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.66
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.66
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.66
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.66
2awx_A105 Synapse associated protein 97; membrane protein, s 99.66
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.66
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.66
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.66
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.65
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.65
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.65
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.65
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.65
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.65
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.65
2ego_A96 General receptor for phosphoinositides 1- associat 99.65
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.65
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.65
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.65
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.65
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.64
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.64
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.64
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.64
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.64
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.64
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.64
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.64
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.64
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.64
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.64
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.63
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.63
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.63
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.63
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.63
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.63
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.63
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.62
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.62
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.62
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.62
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.62
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.62
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.62
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.62
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.62
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.62
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.62
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.62
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.61
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.61
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.61
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.61
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.61
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.6
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.6
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.6
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.6
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.6
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.6
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.6
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.6
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.59
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.59
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.59
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.59
2d90_A102 PDZ domain containing protein 1; structural genomi 99.58
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.58
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.58
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.58
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.58
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.57
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.57
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.57
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.57
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.57
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.57
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.57
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.57
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.57
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.57
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.57
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.56
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.55
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.55
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.55
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.55
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.55
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.55
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.54
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.54
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.54
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.54
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.54
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.54
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.54
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.54
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.53
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.53
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.53
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.53
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.52
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.52
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.51
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.51
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.51
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.51
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.51
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.5
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.5
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.5
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.5
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.5
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.49
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.49
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.48
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.48
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.48
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.48
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.47
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.2
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.47
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.47
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.46
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.46
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.45
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.45
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.45
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.44
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.42
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.42
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.41
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.4
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.4
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.38
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.38
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.37
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.36
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.35
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.33
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.32
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.31
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.3
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.29
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.29
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 99.28
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.27
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.25
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.25
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.23
3k50_A 403 Putative S41 protease; structural genomics, joint 99.22
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.21
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.15
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.1
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.06
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.78
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.77
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.77
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.77
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.76
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.75
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.75
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.74
2kl1_A94 YLBL protein; structure genomics, structural genom 98.73
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.68
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.67
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.64
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.62
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.6
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.59
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.58
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.5
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.49
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.43
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.43
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.42
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.34
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.32
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.3
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.3
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.26
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.16
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.08
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.96
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.92
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.48
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
Probab=99.69  E-value=1.5e-16  Score=112.06  Aligned_cols=84  Identities=25%  Similarity=0.559  Sum_probs=75.5

Q ss_pred             ceEEEEEecCCCCceeEEEEEeecCCCCCcEEEEECCCCcc-ccCCCCCCEEEEECCEECCCCCHHHHHHHHhCCCCeEE
Q psy12310         38 NTFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPA-AAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSIS  116 (201)
Q Consensus        38 ~~~~V~L~r~~~~~~~Gf~i~gG~~~~~pi~V~~V~~gspA-~agL~~GD~Il~Ing~~v~~~~~~~av~~ik~~g~~v~  116 (201)
                      ..++|+|..   ..+|||++.+|.+...+++|..|.++||| .+||++||+|++|||.++.++++.++..+++..+..+.
T Consensus         3 ~~~~v~l~~---~~~~G~~l~~g~~~~~~~~V~~V~~~spA~~aGl~~GD~I~~ing~~v~~~~~~~~~~~~~~~g~~v~   79 (88)
T 2uzc_A            3 SNYSVSLVG---PAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLN   79 (88)
T ss_dssp             CEEEEEEES---SSCCCEEEEEEGGGTEEEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHHTCCSEEE
T ss_pred             cEEEEEEcC---CCcccEEEECcCCCCCCeEEEEECCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHHhCCCeEE
Confidence            467888843   37899999999987788999999999999 89999999999999999999999999999988889999


Q ss_pred             EEEEeCCC
Q psy12310        117 LGIQRNPP  124 (201)
Q Consensus       117 L~v~R~~~  124 (201)
                      |+|.|++.
T Consensus        80 l~v~R~g~   87 (88)
T 2uzc_A           80 MTLQRESD   87 (88)
T ss_dssp             EEEECCCC
T ss_pred             EEEEeCCC
Confidence            99998763



>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 9e-17
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-16
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 9e-16
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-15
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-15
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 5e-15
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-14
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-14
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-14
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-14
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-13
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-13
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-13
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-13
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-13
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 4e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 6e-13
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 8e-13
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 1e-12
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-12
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-12
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 3e-12
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 4e-12
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-12
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 7e-12
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 7e-12
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 9e-12
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-11
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-11
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-11
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-11
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-11
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-11
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-11
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 5e-11
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 5e-11
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-11
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-11
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-10
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-10
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-10
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 7e-10
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-09
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-09
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-09
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-09
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-09
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-09
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 8e-09
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-08
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-08
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 7e-08
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-07
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-07
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-06
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-06
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 1e-05
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-04
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.004
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Zasp (Cypher, Oracle 1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.2 bits (177), Expect = 1e-17
 Identities = 25/86 (29%), Positives = 51/86 (59%), Gaps = 4/86 (4%)

Query: 39  TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPAA-AELKRGDIIRKIGDYDSR 97
            ++V +  P     WG R+ GG D + P+ I+++ PG+ AA ++L +GD++  I   ++ 
Sbjct: 2   AYSVTLTGPG---PWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTD 58

Query: 98  DLRHKDATNFFQSSDTSISLGIQRNP 123
            + H +A N  +S+  ++SL +Q++ 
Sbjct: 59  TMTHLEAQNKIKSASYNLSLTLQKSK 84


>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.83
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.79
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.78
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.77
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.77
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.76
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.76
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.76
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.75
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.75
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.75
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.75
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.74
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.74
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.73
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.73
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.73
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.72
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.72
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.72
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.71
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.71
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.71
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.71
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.7
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.7
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.7
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.7
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.7
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.69
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.69
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.69
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.68
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.68
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.67
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.65
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.65
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.64
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.64
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.64
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.63
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.63
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.62
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.58
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.57
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.57
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.55
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.55
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.53
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.52
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.44
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.32
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.05
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.94
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.92
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.92
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.84
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.8
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.75
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Zasp (Cypher, Oracle 1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=8.3e-21  Score=132.93  Aligned_cols=82  Identities=28%  Similarity=0.647  Sum_probs=76.7

Q ss_pred             eEEEEEecCCCCceeEEEEEeecCCCCCcEEEEECCCCcc-ccCCCCCCEEEEECCEECCCCCHHHHHHHHhCCCCeEEE
Q psy12310         39 TFTVVIKRPNRHHSWGLRIAGGCDLDSPIVITKVYPGTPA-AAELKRGDIIRKIGDYDSRDLRHKDATNFFQSSDTSISL  117 (201)
Q Consensus        39 ~~~V~L~r~~~~~~~Gf~i~gG~~~~~pi~V~~V~~gspA-~agL~~GD~Il~Ing~~v~~~~~~~av~~ik~~g~~v~L  117 (201)
                      .++|+|.+   ..+|||+|.||.+...+++|..|.++||| +++|++||+|++|||.++.+++|.+++.+|+.++..++|
T Consensus         2 p~~V~l~~---~~~~Gf~i~gg~~~~~~v~V~~v~~gs~A~~~~L~~GD~Il~VNg~~v~~~s~~ev~~~i~~~~~~v~L   78 (85)
T d1rgwa_           2 AYSVTLTG---PGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSL   78 (85)
T ss_dssp             EEEEEECC---SSCCCEEECCCGGGTSCCBEEEECTTSHHHHSSCCCCSBEEEETTEECTTCCHHHHHHHHTTCSSCEEE
T ss_pred             CEEEEecC---CCCCCEEEEeecCCCCCEEEEEecCCChHHhCCCCCCCEEEEECCEECCCCCHHHHHHHHHcCCCEEEE
Confidence            47899975   37899999999998889999999999999 899999999999999999999999999999999999999


Q ss_pred             EEEeCC
Q psy12310        118 GIQRNP  123 (201)
Q Consensus       118 ~v~R~~  123 (201)
                      +|.|.+
T Consensus        79 ~V~R~~   84 (85)
T d1rgwa_          79 TLQKSK   84 (85)
T ss_dssp             EEESCC
T ss_pred             EEEECC
Confidence            999876



>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure