Diaphorina citri psyllid: psy12315


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MAVSQVRQNFHAETEEKINKQINLELYASYVYLSMSAHFDRDVVALPGISKYFKHASDEESEHAHKLIKYLNKRGGTLKLVDVKAPARQEWGTTEEAFSHALQLEKDVNQVIIYFFTSLA
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccCEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
*******QNFHAETEEKINKQINLELYASYVYLSMSAHFDRDVVALPGISKYFKHASDEESEHAHKLIKYLNKRGGTLKLVDVKAPARQEWGTTEEAFSHALQLEKDVNQVIIYFFTSLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVSQVRQNFHAETEEKINKQINLELYASYVYLSMSAHFDRDVVALPGISKYFKHASDEESEHAHKLIKYLNKRGGTLKLVDVKAPARQEWGTTEEAFSHALQLEKDVNQVIIYFFTSLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentP09528
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentQ95MP7
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentQ8MIP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048147 [BP]negative regulation of fibroblast proliferationprobableGO:0042127, GO:0008285, GO:0048145, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0006880 [BP]intracellular sequestering of iron ionprobableGO:0050801, GO:0051238, GO:0042592, GO:0055072, GO:0051651, GO:0051235, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0006879, GO:0006875, GO:0009987, GO:0006873, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0055082, GO:0051179, GO:0051641, GO:0048878, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006826 [BP]iron ion transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0060547 [BP]negative regulation of necrotic cell deathprobableGO:0010939, GO:0060548, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051353 [BP]positive regulation of oxidoreductase activityprobableGO:0051341, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0051347 [BP]positive regulation of transferase activityprobableGO:0019222, GO:0050790, GO:0051338, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0016044 [BP]cellular membrane organizationprobableGO:0009987, GO:0016043, GO:0061024, GO:0008150, GO:0071840, GO:0044763, GO:0044699
GO:0051349 [BP]positive regulation of lyase activityprobableGO:0019222, GO:0050790, GO:0051339, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0006892 [BP]post-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006955 [BP]immune responseprobableGO:0002376, GO:0050896, GO:0008150
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0004322 [MF]ferroxidase activityprobableGO:0003824, GO:0016722, GO:0016724, GO:0003674, GO:0016491
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008043 [CC]intracellular ferritin complexprobableGO:0043234, GO:0070288, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008199 [MF]ferric iron bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.16.-.-Oxidizing metal ions.probable
1.16.3.-With oxygen as acceptor.probable
1.16.3.1Ferroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RCD, chain A
Confidence level:very confident
Coverage over the Query: 4-118
View the alignment between query and template
View the model in PyMOL