Diaphorina citri psyllid: psy1231

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-

MSSAAPMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK

ccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccEEEccccccEEEEEECcccccHHHHHHHHcccc

*************************************************************KF**********YGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSAAPMADIQESIKAQGDVVRKLKSSKAPxxxxxxxxxxxxxxxxxxxxxDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histidine--tRNA ligase, cytoplasmic		confident	Q61035
Histidine--tRNA ligase, cytoplasmic		confident	Q2KI84
Histidine--tRNA ligase, cytoplasmic		confident	P12081

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G85, chain A
Confidence level:very confident
Coverage over the Query: 60-145
View the alignment between query and template
View the model in PyMOL