Psyllid ID: psy1231

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MSSAAPMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK
ccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccEEEccccccEEEEEEEcccccHHHHHHHHHccc
cccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHcccEEEEccccHHHHEEEEcccccccEEEEccHccccc
MSSAAPMADIQESIKAQGDVVRKlksskapkeQIDEEVKKLLELKNQLKindeanednsthkfilktpkgtrdygpdstvVRNQVLDKIVKIFKKhgavtidtpIFELKevltgkygvywTGYSTAVGFLMihsvpsaplwinwtnhlgkk
mssaapmadiqesikaqgdVVRKlksskapkeqidEEVKKLLELKNQLKindeanednsthkfilktpkgtrdygpdstVVRNQVLDKIVKIFkkhgavtidtpifelkevLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK
MSSAAPMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK
*************************************************************************YGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNH****
*************************************************************KF**********YGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHL***
*********IQESIKAQG*************EQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK
*******ADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSAAPMADIQESIKAQGDVVRKLKSSKAPxxxxxxxxxxxxxxxxxxxxxDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWTGYSTAVGFLMIHSVPSAPLWINWTNHLGKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q61035 509 Histidine--tRNA ligase, c yes N/A 0.708 0.210 0.557 3e-28
Q5R4R2 509 Histidine--tRNA ligase, c yes N/A 0.708 0.210 0.557 8e-28
P12081 509 Histidine--tRNA ligase, c yes N/A 0.708 0.210 0.557 8e-28
Q2KI84 509 Histidine--tRNA ligase, c yes N/A 0.708 0.210 0.548 1e-27
P07178 508 Histidine--tRNA ligase, c N/A N/A 0.609 0.181 0.581 4e-25
P70076 519 Histidine--tRNA ligase, c N/A N/A 0.523 0.152 0.6 1e-22
O43011 563 Histidine--tRNA ligase, m yes N/A 0.754 0.202 0.5 5e-22
Q86AS6 481 Histidine--tRNA ligase, c yes N/A 0.384 0.120 0.637 2e-16
P34183 521 Histidine--tRNA ligase OS yes N/A 0.370 0.107 0.607 8e-15
P49590 506 Probable histidine--tRNA no N/A 0.503 0.150 0.482 1e-14
>sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=2 SV=2 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 63/113 (55%), Positives = 76/113 (67%), Gaps = 6/113 (5%)

Query: 5   APMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFI 64
           A  A ++E ++ QG  VR LK  KA  EQI+EEV KLL+LK QL       +D    KF+
Sbjct: 2   ADRAALEELVRLQGAHVRGLKEQKASAEQIEEEVTKLLKLKAQL------GQDEGKQKFV 55

Query: 65  LKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYG 117
           LKTPKGTRDY P    VR +V D I++ FK+HGA  IDTP+FELKE LTGKYG
Sbjct: 56  LKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYG 108

Mus musculus (taxid: 10090)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1
>sp|Q5R4R2|SYHC_PONAB Histidine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=HARS PE=2 SV=1 Back     alignment and function description
>sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 Back     alignment and function description
>sp|Q2KI84|SYHC_BOVIN Histidine--tRNA ligase, cytoplasmic OS=Bos taurus GN=HARS PE=2 SV=1 Back     alignment and function description
>sp|P07178|SYHC_MESAU Histidine--tRNA ligase, cytoplasmic OS=Mesocricetus auratus GN=HARS PE=2 SV=1 Back     alignment and function description
>sp|P70076|SYHC_TAKRU Histidine--tRNA ligase, cytoplasmic OS=Takifugu rubripes GN=hars PE=3 SV=1 Back     alignment and function description
>sp|O43011|SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hts1 PE=1 SV=2 Back     alignment and function description
>sp|Q86AS6|SYHC_DICDI Histidine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|P34183|SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans GN=hrs-1 PE=2 SV=3 Back     alignment and function description
>sp|P49590|SYHM_HUMAN Probable histidine--tRNA ligase, mitochondrial OS=Homo sapiens GN=HARS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
348533734 513 PREDICTED: histidyl-tRNA synthetase, cyt 0.682 0.200 0.636 5e-31
410927344 514 PREDICTED: histidine--tRNA ligase, cytop 0.688 0.202 0.627 1e-30
432961037 515 PREDICTED: histidine--tRNA ligase, cytop 0.688 0.201 0.627 2e-30
189236717 514 PREDICTED: similar to Histidyl-tRNA synt 0.675 0.198 0.633 2e-30
432961044 495 PREDICTED: histidine--tRNA ligase, cytop 0.688 0.210 0.627 3e-30
195456738 526 GK17081 [Drosophila willistoni] gi|19417 0.688 0.197 0.596 1e-28
241123591 445 histidyl-tRNA synthetase, putative [Ixod 0.675 0.229 0.596 3e-28
125980688 518 GA19519 [Drosophila pseudoobscura pseudo 0.688 0.200 0.601 3e-28
291387471 509 PREDICTED: histidyl-tRNA synthetase-like 0.708 0.210 0.575 4e-28
195172035211 GL26979 [Drosophila persimilis] gi|19411 0.688 0.492 0.601 4e-28
>gi|348533734|ref|XP_003454360.1| PREDICTED: histidyl-tRNA synthetase, cytoplasmic-like isoform 1 [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 70/110 (63%), Positives = 82/110 (74%), Gaps = 7/110 (6%)

Query: 8   ADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKT 67
           A IQE+IK QG+VVRKLKS KA KEQIDEEV KLLELK QL        D+   +F+LKT
Sbjct: 5   AQIQEAIKIQGEVVRKLKSEKASKEQIDEEVAKLLELKAQLG-------DDGKTQFVLKT 57

Query: 68  PKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYG 117
           PKGTRDY P    +R +V + I++ FK+HGA TIDTP+FELKE LTGKYG
Sbjct: 58  PKGTRDYNPKQMAIREKVFNTIIRCFKRHGAETIDTPVFELKETLTGKYG 107

Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|410927344|ref|XP_003977109.1| PREDICTED: histidine--tRNA ligase, cytoplasmic-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|432961037|ref|XP_004086544.1| PREDICTED: histidine--tRNA ligase, cytoplasmic-like isoform 1 [Oryzias latipes] Back     alignment and taxonomy information
>gi|189236717|ref|XP_974715.2| PREDICTED: similar to Histidyl-tRNA synthetase CG6335-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|432961044|ref|XP_004086546.1| PREDICTED: histidine--tRNA ligase, cytoplasmic-like isoform 3 [Oryzias latipes] Back     alignment and taxonomy information
>gi|195456738|ref|XP_002075266.1| GK17081 [Drosophila willistoni] gi|194171351|gb|EDW86252.1| GK17081 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|241123591|ref|XP_002403927.1| histidyl-tRNA synthetase, putative [Ixodes scapularis] gi|215493555|gb|EEC03196.1| histidyl-tRNA synthetase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|125980688|ref|XP_001354367.1| GA19519 [Drosophila pseudoobscura pseudoobscura] gi|54642675|gb|EAL31420.1| GA19519 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|291387471|ref|XP_002710301.1| PREDICTED: histidyl-tRNA synthetase-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|195172035|ref|XP_002026807.1| GL26979 [Drosophila persimilis] gi|194111746|gb|EDW33789.1| GL26979 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
UNIPROTKB|F1RGD9 509 HARS "Uncharacterized protein" 0.675 0.200 0.574 1.7e-26
MGI|MGI:108087 509 Hars "histidyl-tRNA synthetase 0.708 0.210 0.557 2.2e-26
UNIPROTKB|E2QZ69 509 HARS "Uncharacterized protein" 0.708 0.210 0.557 2.8e-26
RGD|1310695 508 Hars "histidyl-tRNA synthetase 0.708 0.210 0.566 3.6e-26
UNIPROTKB|D6REN6 489 HARS "Histidine--tRNA ligase, 0.708 0.218 0.557 6.4e-26
UNIPROTKB|Q2KI84 509 HARS "Histidine--tRNA ligase, 0.708 0.210 0.548 7.9e-26
UNIPROTKB|P12081 509 HARS "Histidine--tRNA ligase, 0.708 0.210 0.557 7.9e-26
UNIPROTKB|F1ND13 504 HARS "Uncharacterized protein" 0.701 0.210 0.530 1.3e-25
UNIPROTKB|F1NEE7 501 HARS "Uncharacterized protein" 0.688 0.207 0.531 2e-25
POMBASE|SPBC2G2.12 563 hrs1 "mitochondrial and cytopl 0.748 0.200 0.513 4.2e-25
UNIPROTKB|F1RGD9 HARS "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 1.7e-26, P = 1.7e-26
 Identities = 62/108 (57%), Positives = 74/108 (68%)

Query:    10 IQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPK 69
             ++E ++ QG+ VR LK  KA  EQI+EEV KLL+LK QL        D   HKF+LKTPK
Sbjct:     7 LEELVRLQGERVRGLKQQKASTEQIEEEVAKLLKLKAQL------GPDEGKHKFVLKTPK 60

Query:    70 GTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYG 117
             GTRDY P    VR +V D I+  FK+HGA  IDTP+FELKE LTGKYG
Sbjct:    61 GTRDYSPRQMAVREKVFDVIIGCFKRHGAEVIDTPVFELKETLTGKYG 108
GO:0006427 "histidyl-tRNA aminoacylation" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004821 "histidine-tRNA ligase activity" evidence=IEA
MGI|MGI:108087 Hars "histidyl-tRNA synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ69 HARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1310695 Hars "histidyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D6REN6 HARS "Histidine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI84 HARS "Histidine--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P12081 HARS "Histidine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND13 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEE7 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
POMBASE|SPBC2G2.12 hrs1 "mitochondrial and cytoplasmic histidine-tRNA ligase Hrs1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P12081SYHC_HUMAN6, ., 1, ., 1, ., 2, 10.55750.70860.2102yesN/A
Q5R4R2SYHC_PONAB6, ., 1, ., 1, ., 2, 10.55750.70860.2102yesN/A
Q61035SYHC_MOUSE6, ., 1, ., 1, ., 2, 10.55750.70860.2102yesN/A
Q2KI84SYHC_BOVIN6, ., 1, ., 1, ., 2, 10.54860.70860.2102yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
PLN02972 763 PLN02972, PLN02972, Histidyl-tRNA synthetase 6e-17
cd0120042 cd01200, WHEPGMRS_RNA, EPRS-like_RNA binding domai 2e-15
pfam0045856 pfam00458, WHEP-TRS, WHEP-TRS domain 4e-15
COG0124 429 COG0124, HisS, Histidyl-tRNA synthetase [Translati 9e-15
smart0099156 smart00991, WHEP-TRS, A conserved domain of 46 ami 3e-14
PRK00037 412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 4e-13
cd0093650 cd00936, WEPRS_RNA, WEPRS_RNA binding domain 9e-13
cd0093845 cd00938, HisRS_RNA, HisRS_RNA binding domain 2e-12
TIGR00442 397 TIGR00442, hisS, histidyl-tRNA synthetase 2e-12
cd00773 261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA 6e-10
cd0093945 cd00939, MetRS_RNA, MetRS_RNA binding domain 2e-07
PLN02734 684 PLN02734, PLN02734, glycyl-tRNA synthetase 6e-07
PRK12420 423 PRK12420, PRK12420, histidyl-tRNA synthetase; Prov 1e-06
cd0067746 cd00677, S15_NS1_EPRS_RNA-bind, S15/NS1/EPRS_RNA-b 6e-05
cd0093551 cd00935, GlyRS_RNA, GlyRS_RNA binding domain 1e-04
pfam00587171 pfam00587, tRNA-synt_2b, tRNA synthetase class II 2e-04
COG3705 390 COG3705, HisZ, ATP phosphoribosyltransferase invol 7e-04
>gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information 
 Score = 76.1 bits (187), Expect = 6e-17
 Identities = 32/83 (38%), Positives = 48/83 (57%), Gaps = 4/83 (4%)

Query: 35  DEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVLDKIVKIFK 94
           D +      L +++K   E+NE     + + K PKGTRD+  +   +R +    I  +FK
Sbjct: 301 DPKCPGFDSLVDKVKEIVESNEV----RRLPKIPKGTRDFAKEQMAIREKAFSIITSVFK 356

Query: 95  KHGAVTIDTPIFELKEVLTGKYG 117
           +HGA  +DTP+FEL+E L GKYG
Sbjct: 357 RHGATALDTPVFELRETLMGKYG 379

Length = 763
>gnl|CDD|238605 cd01200, WHEPGMRS_RNA, EPRS-like_RNA binding domain Back     alignment and domain information
>gnl|CDD|215929 pfam00458, WHEP-TRS, WHEP-TRS domain Back     alignment and domain information
>gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214960 smart00991, WHEP-TRS, A conserved domain of 46 amino acids, called WHEP-TRS has been shown Back     alignment and domain information
>gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|238473 cd00936, WEPRS_RNA, WEPRS_RNA binding domain Back     alignment and domain information
>gnl|CDD|238474 cd00938, HisRS_RNA, HisRS_RNA binding domain Back     alignment and domain information
>gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|238396 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|238475 cd00939, MetRS_RNA, MetRS_RNA binding domain Back     alignment and domain information
>gnl|CDD|178335 PLN02734, PLN02734, glycyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|238361 cd00677, S15_NS1_EPRS_RNA-bind, S15/NS1/EPRS_RNA-binding domain Back     alignment and domain information
>gnl|CDD|238472 cd00935, GlyRS_RNA, GlyRS_RNA binding domain Back     alignment and domain information
>gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|226228 COG3705, HisZ, ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG1936|consensus 518 99.94
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, riboso 99.72
PLN02972 763 Histidyl-tRNA synthetase 99.7
PLN02530 487 histidine-tRNA ligase 99.6
PRK12292 391 hisZ ATP phosphoribosyltransferase regulatory subu 99.54
PRK12421 392 ATP phosphoribosyltransferase regulatory subunit; 99.53
PRK12420 423 histidyl-tRNA synthetase; Provisional 99.52
CHL00201 430 syh histidine-tRNA synthetase; Provisional 99.51
PRK12293 281 hisZ ATP phosphoribosyltransferase regulatory subu 99.49
TIGR00442 397 hisS histidyl-tRNA synthetase. This model finds a 99.32
PF13393 311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 99.31
PRK00037 412 hisS histidyl-tRNA synthetase; Reviewed 99.29
cd0093845 HisRS_RNA HisRS_RNA binding domain. This short RNA 99.26
cd0093945 MetRS_RNA MetRS_RNA binding domain. This short RNA 99.2
COG3705 390 HisZ ATP phosphoribosyltransferase involved in his 99.15
PLN02734 684 glycyl-tRNA synthetase 99.08
TIGR00443 314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 99.06
PF0045856 WHEP-TRS: WHEP-TRS domain; InterPro: IPR000738 A c 99.05
cd00774 254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 98.89
PRK00413 638 thrS threonyl-tRNA synthetase; Reviewed 98.82
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subu 98.73
cd00779 255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 98.67
cd00773 261 HisRS-like_core Class II Histidinyl-tRNA synthetas 98.57
cd00772 264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 98.52
PRK12305 575 thrS threonyl-tRNA synthetase; Reviewed 98.49
PRK12294 272 hisZ ATP phosphoribosyltransferase regulatory subu 98.49
PRK09194 565 prolyl-tRNA synthetase; Provisional 98.45
cd00771 298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 98.39
TIGR00418 563 thrS threonyl-tRNA synthetase. This model represen 98.38
cd0120042 WHEPGMRS_RNA EPRS-like_RNA binding domain. This sh 98.34
cd0093650 WEPRS_RNA WEPRS_RNA binding domain. This short RNA 98.33
PRK14799 545 thrS threonyl-tRNA synthetase; Provisional 98.33
cd00778 261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 98.17
TIGR00408 472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 98.15
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 98.09
PRK12444 639 threonyl-tRNA synthetase; Reviewed 98.06
PRK08661 477 prolyl-tRNA synthetase; Provisional 97.93
PRK12325 439 prolyl-tRNA synthetase; Provisional 97.89
PLN02908 686 threonyl-tRNA synthetase 97.8
cd00670 235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 97.75
PRK04173 456 glycyl-tRNA synthetase; Provisional 97.66
cd0093551 GlyRS_RNA GlyRS_RNA binding domain. This short RNA 97.66
KOG2298|consensus 599 97.48
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 97.42
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 97.12
TIGR02367 453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 96.94
TIGR00389 551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 96.67
PF00587 173 tRNA-synt_2b: tRNA synthetase class II core domain 95.77
PRK14894 539 glycyl-tRNA synthetase; Provisional 95.35
cd00770 297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 95.24
PRK09350 306 poxB regulator PoxA; Provisional 94.91
cd00776 322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 94.77
TIGR00462 304 genX lysyl-tRNA synthetase-like protein GenX. Many 94.36
PRK09537 417 pylS pyrolysyl-tRNA synthetase; Reviewed 94.29
cd00768 211 class_II_aaRS-like_core Class II tRNA amino-acyl s 93.95
cd00669 269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 91.77
PLN02837 614 threonine-tRNA ligase 90.78
KOG1035|consensus 1351 89.79
TIGR00468 294 pheS phenylalanyl-tRNA synthetase, alpha subunit. 87.72
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, riboso 87.48
cd00777 280 AspRS_core Asp tRNA synthetase (aspRS) class II co 87.38
PRK06462 335 asparagine synthetase A; Reviewed 86.47
TIGR00414 418 serS seryl-tRNA synthetase. This model represents 86.21
PTZ00417 585 lysine-tRNA ligase; Provisional 85.47
PRK00488 339 pheS phenylalanyl-tRNA synthetase subunit alpha; V 85.26
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 85.12
cd00775 329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 84.57
COG2269 322 Truncated, possibly inactive, lysyl-tRNA synthetas 84.54
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 84.44
cd0067746 S15_NS1_EPRS_RNA-bind S15/NS1/EPRS_RNA-binding dom 84.38
PRK12445 505 lysyl-tRNA synthetase; Reviewed 83.56
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 83.52
PF00152 335 tRNA-synt_2: tRNA synthetases class II (D, K and N 83.25
KOG1885|consensus 560 83.22
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 82.97
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 82.94
PLN02603 565 asparaginyl-tRNA synthetase 82.63
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 82.61
PRK03991 613 threonyl-tRNA synthetase; Validated 82.51
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 82.17
PTZ00385 659 lysyl-tRNA synthetase; Provisional 82.04
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 81.43
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 80.97
PLN02502 553 lysyl-tRNA synthetase 80.76
COG1190 502 LysU Lysyl-tRNA synthetase (class II) [Translation 80.68
PRK05431 425 seryl-tRNA synthetase; Provisional 80.29
PLN02532 633 asparagine-tRNA synthetase 80.2
>KOG1936|consensus Back     alignment and domain information 
Probab=99.94  E-value=4e-27  Score=204.65  Aligned_cols=135  Identities=44%  Similarity=0.607  Sum_probs=121.6

Q ss_pred             hHHHHHHHHHhhHHHHhhhcCCCChhhHHHHHHHHHHHHHhhchhhhcccccccCcccccCCCccccCChhhHHHHHHHH
Q psy1231           7 MADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVRNQVL   86 (151)
Q Consensus         7 ~~~l~~~i~~qg~~VR~LK~~ka~k~~I~~~V~kLl~LK~ql~~~~~~~~~~~~~~~~~~~pkGtrD~lP~e~~~~~~I~   86 (151)
                      ...+...++.||+++|.|++++++...|+++|++++++++++.. +   +.-.+.++.+++|+|||||.|++|.+|++|+
T Consensus         6 ~~~~~~~~~~~~~llr~l~~~~a~~~~~~~~va~~~~~~~~~~~-~---~~~~~~k~~lKtPKGTrD~~p~qm~lRe~if   81 (518)
T KOG1936|consen    6 LVTTRESISFQGILLRDLKSSCASPEQISEEVALILALKNGLGR-S---GSIFKKKFSLKTPKGTRDFSPEQMALREKIF   81 (518)
T ss_pred             HHHHHHHHhhhHHHHhhhhhccCChhHhhHHHHHHHHHhcccCC-C---CCCcCcceeecCCCCCCcCCHHHHHHHHHHH
Confidence            56678899999999999999999999999999999999999854 2   1224678899999999999999999999999


Q ss_pred             HHHHHHHHHcCCccccCCccccHHhhhcccCCccc------cc-chhhhhhHHhhCCCcchhhhhc
Q psy1231          87 DKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWT------GY-STAVGFLMIHSVPSAPLWINWT  145 (151)
Q Consensus        87 ~~i~~~f~~~Gy~~IeTPv~E~~evf~~~~Ge~~~------~~-~~~~~~~~~~~~~~~~~~~~~~  145 (151)
                      +++.++|++||+..|+||+||..++|+++||||++      |+ -.-+.+||+|+||.||+++.++
T Consensus        82 ~~i~~vFkrhGa~~iDTPVFElkeiL~gKYGEdskLiYdlkDQGGEl~SLRYDLTVPfARylAmNk  147 (518)
T KOG1936|consen   82 STIKEVFKRHGAETIDTPVFELKEILTGKYGEDSKLIYDLKDQGGELCSLRYDLTVPFARYLAMNK  147 (518)
T ss_pred             HHHHHHHHHcCCeeccccchhHHHHHhhhcccccceeEehhhcCCcEEEeecccccHHHHHHHHcc
Confidence            99999999999999999999999999999999872      22 5567899999999999999884

>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00938 HisRS_RNA HisRS_RNA binding domain Back     alignment and domain information
>cd00939 MetRS_RNA MetRS_RNA binding domain Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PF00458 WHEP-TRS: WHEP-TRS domain; InterPro: IPR000738 A conserved domain of 46 amino acids, called WHEP-TRS has been shown [] to exist in a number of higher eukaryote aminoacyl-transfer RNA synthetases Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>cd01200 WHEPGMRS_RNA EPRS-like_RNA binding domain Back     alignment and domain information
>cd00936 WEPRS_RNA WEPRS_RNA binding domain Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00935 GlyRS_RNA GlyRS_RNA binding domain Back     alignment and domain information
>KOG2298|consensus Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>cd00677 S15_NS1_EPRS_RNA-bind S15/NS1/EPRS_RNA-binding domain Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1885|consensus Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
4g85_A 517 Crystal Structure Of Human Hisrs Length = 517 1e-28
4g84_A 464 Crystal Structure Of Human Hisrs Length = 464 2e-17
1x59_A73 Solution Structures Of The Whep-Trs Domain Of Human 4e-09
2azx_A 477 Charged And Uncharged Trnas Adopt Distinct Conforma 1e-05
1r6t_A 477 Crystal Structure Of Human Tryptophanyl-Trna Synthe 1e-05
2quh_A 477 Crystal Structures Of Human Tryptophanyl-Trna Synth 3e-05
1fyj_A57 Solution Structure Of Multi-Functional Peptide Moti 5e-05
1r1b_A59 Eprs Second Repeated Element, Nmr, Minimized Averag 1e-04
2q5h_A 691 Crystal Structure Of Apo-Wildtype Glycyl-Trna Synth 4e-04
2q5i_A 691 Crystal Structure Of Apo S581l Glycyl-Trna Syntheta 4e-04
2pme_A 693 The Apo Crystal Structure Of The Glycyl-Trna Synthe 4e-04
2pmf_A 693 The Crystal Structure Of A Human Glycyl-trna Synthe 4e-04
>pdb|4G85|A Chain A, Crystal Structure Of Human Hisrs Length = 517 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 63/113 (55%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
Query: 5   APMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFI 64
           A  A ++E +K QG+ VR LK  KA  E I+EEV KLL+LK QL        D S  KF+
Sbjct: 13  AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQL------GPDESKQKFV 66
Query: 65  LKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYG 117
           LKTPKGTRDY P    VR +V D I++ FK+HGA  IDTP+FELKE L GKYG
Sbjct: 67  LKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYG 119
>pdb|4G84|A Chain A, Crystal Structure Of Human Hisrs Length = 464 Back     alignment and structure
>pdb|1X59|A Chain A, Solution Structures Of The Whep-Trs Domain Of Human Histidyl-Trna Synthetase Length = 73 Back     alignment and structure
>pdb|2AZX|A Chain A, Charged And Uncharged Trnas Adopt Distinct Conformations When Complexed With Human Tryptophanyl-Trna Synthetase Length = 477 Back     alignment and structure
>pdb|1R6T|A Chain A, Crystal Structure Of Human Tryptophanyl-Trna Synthetase Length = 477 Back     alignment and structure
>pdb|2QUH|A Chain A, Crystal Structures Of Human Tryptophanyl-Trna Synthetase In Complex With Trp Length = 477 Back     alignment and structure
>pdb|1FYJ|A Chain A, Solution Structure Of Multi-Functional Peptide Motif-1 Present In Human Glutamyl-Prolyl Trna Synthetase (Eprs) Length = 57 Back     alignment and structure
>pdb|1R1B|A Chain A, Eprs Second Repeated Element, Nmr, Minimized Average Structure Length = 59 Back     alignment and structure
>pdb|2Q5H|A Chain A, Crystal Structure Of Apo-Wildtype Glycyl-Trna Synthetase Length = 691 Back     alignment and structure
>pdb|2Q5I|A Chain A, Crystal Structure Of Apo S581l Glycyl-Trna Synthetase Mutant Length = 691 Back     alignment and structure
>pdb|2PME|A Chain A, The Apo Crystal Structure Of The Glycyl-Trna Synthetase Length = 693 Back     alignment and structure
>pdb|2PMF|A Chain A, The Crystal Structure Of A Human Glycyl-trna Synthetase Mutant Length = 693 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1x59_A73 Histidyl-tRNA synthetase; hisrs, structural genomi 1e-20
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 7e-19
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 3e-18
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 1e-16
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 1e-13
1fyj_A57 Multifunctional aminoacyl-tRNA synthetase; helix-t 2e-13
1d2d_A59 TRNA synthetase, tRNA ligase; tRNA synthetase (lig 8e-13
2djv_A79 Methionyl-tRNA synthetase; EC 6.1.1.10, WHEP-TRS d 2e-12
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 1e-11
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 6e-11
3qtc_A 290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 9e-10
1r6t_A 477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 9e-09
1z7m_A 344 ATP phosphoribosyltransferase regulatory subunit; 8e-07
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 3e-06
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 6e-06
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 9e-06
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 1e-05
>1x59_A Histidyl-tRNA synthetase; hisrs, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
 Score = 79.0 bits (194), Expect = 1e-20
 Identities = 35/74 (47%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 2  SSAAPMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTH 61
          S  A  A ++E +K QG+ VR LK  KA  E I+EEV KLL+LK QL        D S  
Sbjct: 6  SGMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLG------PDESKQ 59

Query: 62 KFILKTPKGTRDYG 75
          KF+LKTPK     G
Sbjct: 60 KFVLKTPKSGPSSG 73
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 373 Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 Back     alignment and structure
>1fyj_A Multifunctional aminoacyl-tRNA synthetase; helix-turn-helix, ligase; NMR {Homo sapiens} SCOP: a.16.1.3 Length = 57 Back     alignment and structure
>1d2d_A TRNA synthetase, tRNA ligase; tRNA synthetase (ligase), protein transcription; NMR {Cricetulus griseus} SCOP: a.16.1.3 PDB: 1r1b_A Length = 59 Back     alignment and structure
>2djv_A Methionyl-tRNA synthetase; EC 6.1.1.10, WHEP-TRS domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Length = 693 Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Length = 400 Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Length = 477 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Length = 344 Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Length = 420 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Length = 421 Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Length = 423 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
4g85_A 517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 99.9
4g84_A 464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 99.61
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 99.54
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 99.48
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 99.42
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 99.4
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 99.39
1z7m_A 344 ATP phosphoribosyltransferase regulatory subunit; 99.39
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 99.39
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 99.37
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 99.36
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 99.33
1x59_A73 Histidyl-tRNA synthetase; hisrs, structural genomi 99.28
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.18
2i4l_A 458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 98.83
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum per 98.81
1d2d_A59 TRNA synthetase, tRNA ligase; tRNA synthetase (lig 98.77
1fyj_A57 Multifunctional aminoacyl-tRNA synthetase; helix-t 98.77
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; cla 98.76
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, 98.69
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.68
2djv_A79 Methionyl-tRNA synthetase; EC 6.1.1.10, WHEP-TRS d 98.65
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 98.52
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 98.51
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 98.29
1nj1_A 501 PROR, proline-tRNA synthetase, proline--tRNA ligas 98.28
1ati_A 505 Glycyl-tRNA synthetase; protein biosynthesis, liga 98.17
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 98.15
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.13
3uh0_A 460 Threonyl-tRNA synthetase, mitochondrial; threonine 98.13
1r6t_A 477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 98.08
2dq3_A 425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 97.97
1ses_A 421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 97.63
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 97.52
2cja_A 522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 97.32
1usy_A 275 ATP phosphoribosyltransferase regulatory subunit; 97.25
1nnh_A 294 Asparaginyl-tRNA synthetase-related peptide; struc 97.07
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 94.78
3dsq_A 288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 94.58
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; in 94.56
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 93.94
3vbb_A 522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 93.93
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 93.73
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 93.58
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 93.48
3qtc_A 290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 93.45
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 93.27
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 92.43
3ikl_A 459 DNA polymerase subunit gamma-2, mitochondrial; tra 92.4
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 91.72
3err_A 536 Fusion protein of microtubule binding domain from 91.1
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 90.38
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 89.9
3lss_A 484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 89.64
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 88.15
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 87.83
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 86.74
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 86.42
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 86.11
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 86.09
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 84.69
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=3.7e-25  Score=194.53  Aligned_cols=137  Identities=48%  Similarity=0.670  Sum_probs=73.4

Q ss_pred             CccchHHHHHHHHHhhHHHHhhhcCCCChhhHHHHHHHHHHHHHhhchhhhcccccccCcccccCCCccccCChhhHHHH
Q psy1231           3 SAAPMADIQESIKAQGDVVRKLKSSKAPKEQIDEEVKKLLELKNQLKINDEANEDNSTHKFILKTPKGTRDYGPDSTVVR   82 (151)
Q Consensus         3 ~~~~~~~l~~~i~~qg~~VR~LK~~ka~k~~I~~~V~kLl~LK~ql~~~~~~~~~~~~~~~~~~~pkGtrD~lP~e~~~~   82 (151)
                      .|++...|.+.|+.||+.+|.||+.++++..|+++|++|++||++++. +     ..+.+|++++|+|||||+|.++.++
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~-~-----~~~~~~~l~~P~G~~D~lP~~~~~~   84 (517)
T 4g85_A           11 QMAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP-D-----ESKQKFVLKTPKGTRDYSPRQMAVR   84 (517)
T ss_dssp             ---------------------------------------------------------CCCCCCCCCTTCCCBCHHHHHHH
T ss_pred             ccccHHHHHHHHHHhhhhhcccccccCCHHHHHHHHHHHHHhhhhcCC-c-----ccccceeeeCCCCCCccCHHHHHHH
Confidence            366777889999999999999999999999999999999999999876 3     5677899999999999999999999


Q ss_pred             HHHHHHHHHHHHHcCCccccCCccccHHhhhcccCCccc------cc-chhhhhhHHhhCCCcchhhhhc
Q psy1231          83 NQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWT------GY-STAVGFLMIHSVPSAPLWINWT  145 (151)
Q Consensus        83 ~~I~~~i~~~f~~~Gy~~IeTPv~E~~evf~~~~Ge~~~------~~-~~~~~~~~~~~~~~~~~~~~~~  145 (151)
                      ++|++.++++|++|||.+|+||+||+.|+|.+++|++..      |. .+.++++.+.+.|.+|+++.+.
T Consensus        85 ~~ie~~i~~~~~~~Gy~eI~tP~lE~~el~~~~~ge~~~~my~f~D~~g~~l~LRPd~T~~~aR~~~~~~  154 (517)
T 4g85_A           85 EKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK  154 (517)
T ss_dssp             HHHHHHHHHHHHHHTCEECBCCSEEEHHHHHCC------CSCBBCCTTSCCEEECSCSHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHCCCeEEECcccCcHHHhhcccCcCcceeEEEECCCCCEEEeCCcCcHHHHHHHHhCC
Confidence            999999999999999999999999999999999998632      22 5678899999999999887653
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1x59_A Histidyl-tRNA synthetase; hisrs, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>1d2d_A TRNA synthetase, tRNA ligase; tRNA synthetase (ligase), protein transcription; NMR {Cricetulus griseus} SCOP: a.16.1.3 PDB: 1r1b_A Back     alignment and structure
>1fyj_A Multifunctional aminoacyl-tRNA synthetase; helix-turn-helix, ligase; NMR {Homo sapiens} SCOP: a.16.1.3 Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>2djv_A Methionyl-tRNA synthetase; EC 6.1.1.10, WHEP-TRS domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1h4vb2 324 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisR 6e-16
d1qe0a2 325 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisR 7e-16
d1kmma2 322 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisR 2e-15
d1r6ta154 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic 4e-15
d1fyja_57 a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthas 7e-15
d1d2da_56 a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthas 1e-14
d1wu7a2 327 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisR 1e-14
d1z7ma1 318 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase 4e-12
d1usya_ 275 d.104.1.1 (A:) ATP phosphoribosyltransferase regul 6e-04
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Length = 324 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Thermus thermophilus [TaxId: 274]

 Score = 70.8 bits (172), Expect = 6e-16
 Identities = 13/53 (24%), Positives = 25/53 (47%)

Query: 65  LKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYG 117
            +  +GT+D       +  +++    K+ +  GA+ + TPIFE  +V     G
Sbjct: 2   ARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVG 54
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Length = 325 Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure
>d1r6ta1 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure
>d1fyja_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1d2da_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 56 Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 327 Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Length = 318 Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1kmma2 322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 99.55
d1wu7a2 327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 99.54
d1qe0a2 325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 99.5
d1h4vb2 324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 99.46
d1z7ma1 318 ATP phosphoribosyltransferase regulatory subunit H 99.4
d1r6ta154 N-terminal domain of eukaryotic tryptophanyl-tRNA 99.31
d1fyja_57 Multifunctional Glu-Pro-tRNA synthase (EPRS) secon 99.24
d1d2da_56 Multifunctional Glu-Pro-tRNA synthase (EPRS) secon 99.2
d1nj8a3 268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 97.76
d1usya_ 275 ATP phosphoribosyltransferase regulatory subunit H 97.75
d1b76a2 331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 97.47
d1hc7a2 272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 97.24
d1atia2 394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 96.6
d1nj1a3 265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 95.72
d1qf6a4 291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 95.62
d1nyra4 291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 94.86
d1b8aa2 335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 92.66
d1eova2 353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 91.06
d1n9wa2 304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 90.69
d1c0aa3 346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 90.64
d1l0wa3 356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 89.71
d1e1oa2 342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 89.21
d1nnha_ 293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 88.63
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Escherichia coli [TaxId: 562]

Probab=99.55  E-value=4.5e-16  Score=126.13  Aligned_cols=82  Identities=15%  Similarity=0.195  Sum_probs=71.6

Q ss_pred             ccCCCccccCChhhHHHHHHHHHHHHHHHHHcCCccccCCccccHHhhhcccCCccc----cc-------chhhhhhHHh
Q psy1231          65 LKTPKGTRDYGPDSTVVRNQVLDKIVKIFKKHGAVTIDTPIFELKEVLTGKYGVYWT----GY-------STAVGFLMIH  133 (151)
Q Consensus        65 ~~~pkGtrD~lP~e~~~~~~I~~~i~~~f~~~Gy~~IeTPv~E~~evf~~~~Ge~~~----~~-------~~~~~~~~~~  133 (151)
                      +++|+||||++|+++..+++|++.+.++|++|||.+|+||+||++|+|..++|+...    ..       ...+++|.++
T Consensus         2 ~~~~~G~~D~lp~~~~~~~~i~~~l~~~f~~~Gy~~I~tP~lE~~d~~~~~~g~~~~~~~~~~~~~~d~~g~~l~Lr~D~   81 (322)
T d1kmma2           2 IQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEG   81 (322)
T ss_dssp             CCCCTTCCCBCHHHHHHHHHHHHHHHHHHHTTTCEECBCCSEEEHHHHHHHHCTTSHHHHHTCEEEECTTSCEEEECSCS
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCeEeECcccccHHHhhcccCcchhhhHHHHhhhhhcccccccccccc
Confidence            689999999999999999999999999999999999999999999999988877421    11       4678889999


Q ss_pred             hCCCcchhhhhcc
Q psy1231         134 SVPSAPLWINWTN  146 (151)
Q Consensus       134 ~~~~~~~~~~~~~  146 (151)
                      +.|.+|..++...
T Consensus        82 T~~iaR~~~~~~~   94 (322)
T d1kmma2          82 TAGCVRAGIEHGL   94 (322)
T ss_dssp             HHHHHHHHHHTTC
T ss_pred             cchhhHHHHhhhh
Confidence            9999998886543
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r6ta1 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyja_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2da_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure