Diaphorina citri psyllid: psy12370


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSTLLNAQRCSANGFLLVKPSLLGTNFGINTGHQLSELPCAFMFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDVEGVPP
cccccccccccccCEEEEECcccccccccccccccccccccEEEEcccccccEEEEcccccccccccccEEEEEEEccccEEEEEEEEEEEccccc
**T****QRCSANGFLLVKPSLLGTNFGINTGHQLSELPCAFMFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDVEG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLLNAQRCSANGFLLVKPSLLGTNFGINTGHQLSELPCAFMFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDVEGVPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Suppressor of lurcher protein 1 Accessory protein required for glutamate-gated currents. May participate in the gating of non-NMDA (N-methyl-D-aspartate) ionotropic glutamate receptors such as glr-1.confidentQ93212

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0032589 [CC]neuron projection membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0005575, GO:0097458, GO:0071944, GO:0043005, GO:0044425, GO:0044464, GO:0005886, GO:0042995, GO:0044459
GO:0045202 [CC]synapseprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 37-94
View the alignment between query and template
View the model in PyMOL
Template: 1NT0, chain A
Confidence level:very confident
Coverage over the Query: 5-19,31-94
View the alignment between query and template
View the model in PyMOL