Diaphorina citri psyllid: psy12373


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCSSGHHP
ccccHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccc
**WGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPC******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCSSGHHP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B89, chain A
Confidence level:confident
Coverage over the Query: 34-47,63-198
View the alignment between query and template
View the model in PyMOL