Psyllid ID: psy12373


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCSSGHHP
cccHHccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccc
ccccEEEcccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHEEEEHHccccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccc
mgwgaltldrgkwtlyesagnyEKAATCYIQLKNWTkigqllphikSATTFIQYAKAKEAMGSYResvgayeraedydnVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKflleedepnpvELKRLAIHFEEDKGVLTSFRvsqqsrampcssghhp
mgwgaltldrgkwTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAvdivkakkctEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFrvsqqsrampcssghhp
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCSSGHHP
**WGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEE*****VELKRLAIHFEEDKGVL********************
******TLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPC******
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVS**************
*GWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWGALTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRVSQQSRAMPCSSGHHP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q3UGF1 1341 WD repeat-containing prot yes N/A 0.808 0.119 0.459 5e-37
Q8NEZ3 1342 WD repeat-containing prot yes N/A 0.883 0.130 0.438 7e-37
>sp|Q3UGF1|WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus GN=Wdr19 PE=1 SV=1 Back     alignment and function desciption
 Score =  154 bits (388), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 111/161 (68%), Gaps = 1/161 (0%)

Query: 15   LYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERA 74
            LYE    Y++AA+ YI+ KNW K+G+LLPH+ S    +QYAKAKEA G Y+E+V AYE A
Sbjct: 862  LYEKGQYYDRAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENA 921

Query: 75   EDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQ 134
            + +++V+R+ LDHLN+   AV IV+  +  +GAK +A +  + GD+G+AI FL+LSKC  
Sbjct: 922  KQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVLSKCNN 981

Query: 135  DAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDK 175
            +AF L+QQH K+  +   +  ED  N  + + +A++FE +K
Sbjct: 982  EAFTLAQQHNKMEIYADIIGAEDTTNE-DYQSIALYFEGEK 1021




May be involved in cilia function and/or assembly.
Mus musculus (taxid: 10090)
>sp|Q8NEZ3|WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens GN=WDR19 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
307199281 1364 WD repeat-containing protein 19 [Harpegn 0.828 0.120 0.502 2e-39
383852095 1371 PREDICTED: WD repeat-containing protein 0.888 0.128 0.464 2e-38
340728719 1370 PREDICTED: WD repeat-containing protein 0.818 0.118 0.496 3e-38
350415643 1397 PREDICTED: WD repeat-containing protein 0.818 0.115 0.490 5e-38
345481135 1370 PREDICTED: WD repeat-containing protein 0.828 0.119 0.479 7e-38
307172988 1241 WD repeat-containing protein 19 [Campono 0.838 0.133 0.479 9e-38
380023292 498 PREDICTED: WD repeat-containing protein 0.818 0.325 0.490 1e-37
332029303 1241 WD repeat-containing protein 19 [Acromyr 0.838 0.133 0.473 1e-37
344279333 1396 PREDICTED: WD repeat-containing protein 0.808 0.114 0.472 1e-36
327273245 1344 PREDICTED: WD repeat-containing protein 0.808 0.119 0.465 3e-36
>gi|307199281|gb|EFN79934.1| WD repeat-containing protein 19 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 113/167 (67%), Gaps = 3/167 (1%)

Query: 15   LYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERA 74
            LYE A  ++KAA+ YI+LKNW K+GQLLP I SA   IQYAKAKE+ G Y E+  AYE A
Sbjct: 870  LYERAEYFDKAASAYIKLKNWHKVGQLLPQISSAKINIQYAKAKESEGKYEEAAKAYETA 929

Query: 75   EDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQ 134
            +DYDN++R++L+HLN+   +V++V+  K  EGAK +A Y  K  D+ AAI FLILS C+ 
Sbjct: 930  KDYDNIIRINLEHLNNPARSVEVVQQTKSIEGAKMVAKYFQKMNDYNAAIKFLILSNCHD 989

Query: 135  DAFNLSQQHKKLHEFGKFLLEEDEPNPV---ELKRLAIHFEEDKGVL 178
            +AF L+ QH K+  +G+ L+   E   V   + K LA+HFE  K  L
Sbjct: 990  EAFQLANQHGKMELYGEILVNTIEDTNVRKEDFKSLAMHFESQKNNL 1036




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852095|ref|XP_003701564.1| PREDICTED: WD repeat-containing protein 19-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340728719|ref|XP_003402665.1| PREDICTED: WD repeat-containing protein 19-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415643|ref|XP_003490704.1| PREDICTED: WD repeat-containing protein 19-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345481135|ref|XP_001606822.2| PREDICTED: WD repeat-containing protein 19-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307172988|gb|EFN64130.1| WD repeat-containing protein 19 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380023292|ref|XP_003695458.1| PREDICTED: WD repeat-containing protein 19-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|332029303|gb|EGI69286.1| WD repeat-containing protein 19 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|344279333|ref|XP_003411443.1| PREDICTED: WD repeat-containing protein 19 [Loxodonta africana] Back     alignment and taxonomy information
>gi|327273245|ref|XP_003221391.1| PREDICTED: WD repeat-containing protein 19-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
UNIPROTKB|B4DGR6 1182 WDR19 "WD repeat-containing pr 0.883 0.148 0.438 4.2e-35
RGD|1306997 1340 Wdr19 "WD repeat domain 19" [R 0.808 0.119 0.459 5.2e-35
MGI|MGI:2443231 1341 Wdr19 "WD repeat domain 19" [M 0.808 0.119 0.459 5.2e-35
UNIPROTKB|Q8NEZ3 1342 WDR19 "WD repeat-containing pr 0.883 0.130 0.438 5.2e-35
UNIPROTKB|E1C1Y1 1342 WDR19 "Uncharacterized protein 0.808 0.119 0.453 6.6e-35
UNIPROTKB|E1B7Q4 1342 WDR19 "Uncharacterized protein 0.808 0.119 0.459 1.1e-34
UNIPROTKB|F1Q2A8 1338 WDR19 "Uncharacterized protein 0.808 0.119 0.447 1.3e-33
UNIPROTKB|I3LLZ8 1330 WDR19 "Uncharacterized protein 0.808 0.120 0.447 3.3e-33
WB|WBGene00001118 1383 dyf-2 [Caenorhabditis elegans 0.782 0.112 0.388 3.3e-25
FB|FBgn0034452 1366 Oseg6 "Oseg6" [Drosophila mela 0.828 0.120 0.390 3.1e-24
UNIPROTKB|B4DGR6 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 392 (143.0 bits), Expect = 4.2e-35, P = 4.2e-35
 Identities = 79/180 (43%), Positives = 118/180 (65%)

Query:    15 LYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERA 74
             LYE    Y+KAA+ YI+ KNW K+G LLPH+ S    +QYAKAKEA G Y+E+V AYE A
Sbjct:   702 LYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENA 761

Query:    75 EDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQ 134
             + + +V+R+ LDHLN+   AV+IV+  +  +GAK +A +  + GD+G+AI FL++SKC  
Sbjct:   762 KQWQSVIRIYLDHLNNPEKAVNIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVMSKCNN 821

Query:   135 DAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKGVLTSFRV----SQQSRAM 190
             +AF L+QQH K+  +   +  ED  N  + + +A++FE +K  L + +      Q SRA+
Sbjct:   822 EAFTLAQQHNKMEIYADIIGSEDTTNE-DYQSIALYFEGEKRYLQAGKFFLLCGQYSRAL 880




GO:0001701 "in utero embryonic development" evidence=IEA
GO:0030326 "embryonic limb morphogenesis" evidence=IEA
GO:0031076 "embryonic camera-type eye development" evidence=IEA
GO:0031514 "motile cilium" evidence=IEA
GO:0032391 "photoreceptor connecting cilium" evidence=IEA
GO:0042384 "cilium assembly" evidence=IEA
GO:0042471 "ear morphogenesis" evidence=IEA
GO:0048701 "embryonic cranial skeleton morphogenesis" evidence=IEA
GO:0050877 "neurological system process" evidence=IEA
GO:0055123 "digestive system development" evidence=IEA
GO:0060830 "ciliary receptor clustering involved in smoothened signaling pathway" evidence=IEA
GO:0060831 "smoothened signaling pathway involved in dorsal/ventral neural tube patterning" evidence=IEA
GO:0061055 "myotome development" evidence=IEA
RGD|1306997 Wdr19 "WD repeat domain 19" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443231 Wdr19 "WD repeat domain 19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NEZ3 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1Y1 WDR19 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7Q4 WDR19 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2A8 WDR19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLZ8 WDR19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00001118 dyf-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0034452 Oseg6 "Oseg6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
KOG3617|consensus 1416 99.95
KOG3617|consensus 1416 99.93
KOG3616|consensus 1636 99.84
KOG1538|consensus 1081 99.82
KOG2041|consensus 1189 99.79
KOG3616|consensus 1636 99.77
KOG2041|consensus 1189 99.66
KOG1538|consensus 1081 99.59
KOG1920|consensus 1265 99.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
KOG1586|consensus288 98.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.77
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.75
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.7
PLN03218 1060 maturation of RBCL 1; Provisional 98.67
PLN03218 1060 maturation of RBCL 1; Provisional 98.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.66
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.64
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.62
KOG2247|consensus 615 98.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.61
PRK11788389 tetratricopeptide repeat protein; Provisional 98.6
PLN03077 857 Protein ECB2; Provisional 98.55
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.54
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.54
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.51
KOG0985|consensus 1666 98.49
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.48
PLN03077 857 Protein ECB2; Provisional 98.44
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.4
KOG0276|consensus794 98.35
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.34
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.31
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.3
KOG2003|consensus 840 98.27
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.23
KOG1920|consensus 1265 98.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.2
KOG4626|consensus 966 98.18
KOG1840|consensus508 98.12
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.1
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.07
KOG4626|consensus 966 98.04
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.0
KOG0985|consensus 1666 97.95
KOG1840|consensus 508 97.94
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.88
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.82
PRK11189296 lipoprotein NlpI; Provisional 97.81
KOG0276|consensus794 97.8
KOG1586|consensus288 97.79
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.7
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.69
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.66
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.65
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 97.63
KOG2003|consensus 840 97.6
smart00299140 CLH Clathrin heavy chain repeat homology. 97.57
PRK12370553 invasion protein regulator; Provisional 97.53
KOG1585|consensus 308 97.5
KOG2114|consensus 933 97.49
PRK15359144 type III secretion system chaperone protein SscB; 97.48
PRK10803263 tol-pal system protein YbgF; Provisional 97.42
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.4
smart00299140 CLH Clathrin heavy chain repeat homology. 97.28
PRK12370553 invasion protein regulator; Provisional 97.24
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.23
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.2
KOG2114|consensus 933 97.19
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.18
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.18
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.15
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.15
KOG1126|consensus638 97.13
PRK10370198 formate-dependent nitrite reductase complex subuni 97.11
KOG1585|consensus308 97.09
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.09
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.09
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.08
PRK15359144 type III secretion system chaperone protein SscB; 97.05
KOG1155|consensus559 96.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.96
KOG0547|consensus606 96.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.76
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.74
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.72
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 96.7
KOG1155|consensus559 96.7
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.67
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.65
PF12688120 TPR_5: Tetratrico peptide repeat 96.62
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 96.6
KOG2376|consensus 652 96.6
PF12688120 TPR_5: Tetratrico peptide repeat 96.54
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 96.53
KOG1126|consensus638 96.52
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.51
KOG1524|consensus737 96.47
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.45
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.45
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.42
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.42
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.3
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.3
KOG0547|consensus606 96.3
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.29
KOG2002|consensus 1018 96.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.25
KOG0495|consensus913 96.24
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.12
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 96.0
KOG0553|consensus304 95.99
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.99
KOG1129|consensus478 95.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.95
KOG2076|consensus 895 95.95
PRK14574 822 hmsH outer membrane protein; Provisional 95.92
KOG1125|consensus579 95.89
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.88
KOG2076|consensus 895 95.87
KOG2247|consensus 615 95.87
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 95.84
PRK14574 822 hmsH outer membrane protein; Provisional 95.83
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.82
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.82
PRK11189296 lipoprotein NlpI; Provisional 95.81
KOG1128|consensus 777 95.8
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.74
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.72
PF12931284 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_ 95.69
KOG0686|consensus 466 95.54
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.41
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.36
KOG1173|consensus611 95.34
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 95.32
PRK10370198 formate-dependent nitrite reductase complex subuni 95.31
KOG1173|consensus611 95.27
KOG0543|consensus397 95.27
KOG0292|consensus 1202 95.24
PRK10803263 tol-pal system protein YbgF; Provisional 95.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.23
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.2
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.17
PF1337173 TPR_9: Tetratricopeptide repeat 95.1
KOG1129|consensus478 95.07
KOG2005|consensus 878 95.05
PRK04841 903 transcriptional regulator MalT; Provisional 94.86
COG5110 881 RPN1 26S proteasome regulatory complex component [ 94.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.74
KOG3785|consensus557 94.67
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.63
KOG0553|consensus304 94.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.44
KOG0548|consensus539 94.42
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.4
PRK15331165 chaperone protein SicA; Provisional 94.33
PRK04841 903 transcriptional regulator MalT; Provisional 94.26
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.23
PF1342844 TPR_14: Tetratricopeptide repeat 94.05
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 93.89
KOG3060|consensus289 93.87
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.74
PRK15331165 chaperone protein SicA; Provisional 93.7
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 93.62
KOG1130|consensus 639 93.58
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.5
KOG2066|consensus846 93.49
KOG2168|consensus835 93.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 93.48
KOG0624|consensus 504 93.28
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.27
KOG0550|consensus486 93.25
KOG2376|consensus 652 93.03
KOG0307|consensus 1049 92.88
KOG2066|consensus 846 92.35
KOG2280|consensus829 92.34
KOG2002|consensus 1018 92.32
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.3
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.29
KOG2168|consensus 835 92.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 92.11
PF1337173 TPR_9: Tetratricopeptide repeat 91.88
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.69
KOG0543|consensus397 91.52
KOG1064|consensus 2439 91.47
KOG1127|consensus 1238 91.42
KOG4162|consensus799 91.36
PF1342844 TPR_14: Tetratricopeptide repeat 91.23
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.16
KOG1174|consensus564 90.85
PF12931 284 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_ 90.76
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.52
KOG0307|consensus 1049 90.43
KOG2005|consensus 878 90.33
COG5110 881 RPN1 26S proteasome regulatory complex component [ 90.23
KOG2034|consensus 911 89.85
KOG4121|consensus 1128 89.58
COG4700251 Uncharacterized protein conserved in bacteria cont 89.43
PF03704146 BTAD: Bacterial transcriptional activator domain; 89.19
KOG1125|consensus579 89.13
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.79
KOG2280|consensus829 88.48
PF1343134 TPR_17: Tetratricopeptide repeat 88.47
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.27
KOG1174|consensus564 88.24
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.18
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.1
KOG4340|consensus 459 87.71
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.58
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.44
KOG2300|consensus629 87.33
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 87.27
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 87.14
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 86.86
KOG1915|consensus 677 86.71
PF13512142 TPR_18: Tetratricopeptide repeat 86.5
KOG4162|consensus 799 86.39
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 86.24
KOG3081|consensus299 86.18
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.13
KOG2047|consensus 835 85.93
PRK10153517 DNA-binding transcriptional activator CadC; Provis 85.78
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.73
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 85.07
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 84.8
KOG3785|consensus 557 84.68
KOG2034|consensus 911 84.6
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 84.43
PF1285434 PPR_1: PPR repeat 84.32
PRK11619 644 lytic murein transglycosylase; Provisional 84.25
PF13934226 ELYS: Nuclear pore complex assembly 84.03
KOG0687|consensus393 83.45
KOG0495|consensus913 83.4
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 83.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 83.09
PF03704146 BTAD: Bacterial transcriptional activator domain; 83.02
KOG1156|consensus 700 82.86
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 82.79
KOG2047|consensus835 82.43
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 82.37
KOG0624|consensus 504 82.35
PF0421269 MIT: MIT (microtubule interacting and transport) d 81.93
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.8
COG2976207 Uncharacterized protein conserved in bacteria [Fun 81.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 80.85
KOG1524|consensus737 80.76
KOG3060|consensus289 80.67
KOG1128|consensus 777 80.27
>KOG3617|consensus Back     alignment and domain information
Probab=99.95  E-value=2.4e-27  Score=210.47  Aligned_cols=188  Identities=15%  Similarity=0.232  Sum_probs=169.0

Q ss_pred             cchHHHHHHHHHHcCCHHHHHHHHHHccCHHHHHhhhh------------------------------------------
Q psy12373          6 LTLDRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLP------------------------------------------   43 (198)
Q Consensus         6 ~~~~~~Aa~~y~~~g~~~~Ai~~y~~~~~~~~a~~l~~------------------------------------------   43 (198)
                      +|+.++|..+|.+|.++|..-.+|...|.|+.|.+++.                                          
T Consensus       813 LgMlEeA~~lYr~ckR~DLlNKlyQs~g~w~eA~eiAE~~DRiHLr~Tyy~yA~~Lear~Di~~AleyyEK~~~hafev~  892 (1416)
T KOG3617|consen  813 LGMLEEALILYRQCKRYDLLNKLYQSQGMWSEAFEIAETKDRIHLRNTYYNYAKYLEARRDIEAALEYYEKAGVHAFEVF  892 (1416)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHhhccceehhhhHHHHHHHHHhhccHHHHHHHHHhcCChHHHHH
Confidence            47788888888888888888888888888887666654                                          


Q ss_pred             ---------------ccCChHHHHHHHHHHHHcCCHHHHHHHHHHhcCHHHHHHHHhhccCCHHHHHHHHHhcCCHHHHH
Q psy12373         44 ---------------HIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAK  108 (198)
Q Consensus        44 ---------------~~~~~~l~~~~A~~~e~~g~~~~A~~~Y~ka~~~~~av~l~~~~~~~~~~a~~l~~~~~~~~~~~  108 (198)
                                     +..++.|+.|||+++|+.|+.+.|+.+|.+|.||-+.||+.| ..|+.++|.+|++++++..+.+
T Consensus       893 rmL~e~p~~~e~Yv~~~~d~~L~~WWgqYlES~GemdaAl~~Y~~A~D~fs~VrI~C-~qGk~~kAa~iA~esgd~AAcY  971 (1416)
T KOG3617|consen  893 RMLKEYPKQIEQYVRRKRDESLYSWWGQYLESVGEMDAALSFYSSAKDYFSMVRIKC-IQGKTDKAARIAEESGDKAACY  971 (1416)
T ss_pred             HHHHhChHHHHHHHHhccchHHHHHHHHHHhcccchHHHHHHHHHhhhhhhheeeEe-eccCchHHHHHHHhcccHHHHH
Confidence                           234788999999999999999999999999999999999999 9999999999999999999999


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHcCChHHHHHHHHHcchhhHHhhhhhhcCCCCHHHHHHHHHHHHhCC-ChhhH----Hhc
Q psy12373        109 RIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDK-GVLTS----FRV  183 (198)
Q Consensus       109 ~~A~~~~~~g~~~~Av~~y~~ag~~~~A~~la~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~e~~g-~~~~A----~~a  183 (198)
                      ++|++|++.|++.+||.||.+|..+..|||||+++++-|.+..   |...+.|+.....|+|||+.| +..+|    ++|
T Consensus       972 hlaR~YEn~g~v~~Av~FfTrAqafsnAIRlcKEnd~~d~L~n---lal~s~~~d~v~aArYyEe~g~~~~~AVmLYHkA 1048 (1416)
T KOG3617|consen  972 HLARMYENDGDVVKAVKFFTRAQAFSNAIRLCKENDMKDRLAN---LALMSGGSDLVSAARYYEELGGYAHKAVMLYHKA 1048 (1416)
T ss_pred             HHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHH---HHhhcCchhHHHHHHHHHHcchhhhHHHHHHHhh
Confidence            9999999999999999999999999999999999998855444   566778899999999999999 88889    999


Q ss_pred             CChhhHHhhhhhcC
Q psy12373        184 SQQSRAMPCSSGHH  197 (198)
Q Consensus       184 g~~~~Al~l~~~~~  197 (198)
                      |.+.+|++|.|..+
T Consensus      1049 Gm~~kALelAF~tq 1062 (1416)
T KOG3617|consen 1049 GMIGKALELAFRTQ 1062 (1416)
T ss_pred             cchHHHHHHHHhhc
Confidence            99999999998753



>KOG3617|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF12931 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_C Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG2005|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2168|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2168|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PF12931 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_C Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2005|consensus Back     alignment and domain information
>COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG4121|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.56
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.53
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 99.14
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.97
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.96
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 98.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.87
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.86
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.84
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.81
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.81
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.79
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.79
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.76
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.72
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.69
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.67
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.65
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.64
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.63
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 98.6
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.56
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.55
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.54
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.52
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.47
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.47
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.47
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.43
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.42
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.41
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.41
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.4
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.37
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.37
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.37
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.37
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.36
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.34
3u4t_A272 TPR repeat-containing protein; structural genomics 98.33
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.33
3u4t_A272 TPR repeat-containing protein; structural genomics 98.32
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.31
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.29
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.29
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.26
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.26
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.24
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.19
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.19
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.18
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.15
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.03
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.99
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.99
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.97
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.97
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.96
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.94
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.93
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.92
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.91
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.89
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.86
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.86
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.85
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.85
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.84
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.83
2pm7_A399 Protein WEB1, protein transport protein SEC31; bet 97.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.81
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.81
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.81
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.8
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.8
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.79
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.77
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.73
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.72
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.7
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.69
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.65
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.62
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.6
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.6
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.6
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.58
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.57
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.56
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.54
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.54
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.53
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.53
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.49
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.48
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.47
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.41
3k9i_A117 BH0479 protein; putative protein binding protein, 97.41
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.36
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.35
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.33
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.32
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.29
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.28
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.27
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.25
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.18
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.17
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.14
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.11
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 97.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.03
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.9
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.89
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.88
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 96.84
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.79
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.76
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.72
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.7
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 96.68
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.63
3k9i_A117 BH0479 protein; putative protein binding protein, 96.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.58
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.54
2pm7_A 399 Protein WEB1, protein transport protein SEC31; bet 96.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.38
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.16
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.05
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.97
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.9
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.49
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.45
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.63
3mzk_B441 Protein transport protein SEC16; alpha-helical-sta 94.51
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.09
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.55
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 93.46
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.34
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.79
2wpv_A 312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.71
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.7
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 91.68
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.31
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 91.12
3qil_A125 Clathrin heavy chain 1; clathrin trimerization dom 89.97
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.25
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.06
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 88.32
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 87.79
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.63
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 87.16
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 86.61
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 86.52
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 85.54
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 84.01
3mzk_B 441 Protein transport protein SEC16; alpha-helical-sta 83.5
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 82.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 81.79
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 81.64
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
Probab=99.72  E-value=4.7e-16  Score=147.78  Aligned_cols=146  Identities=14%  Similarity=0.147  Sum_probs=121.4

Q ss_pred             cchHHHHHHHHHHcCCHHHHHHHHH-HccCHHHHHhhhhccCChHHHHHHHHHHHHcCCHHHHHHHHHHhcCHHH---HH
Q psy12373          6 LTLDRGKWTLYESAGNYEKAATCYI-QLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDN---VV   81 (198)
Q Consensus         6 ~~~~~~Aa~~y~~~g~~~~Ai~~y~-~~~~~~~a~~l~~~~~~~~l~~~~A~~~e~~g~~~~A~~~Y~ka~~~~~---av   81 (198)
                      +|+|++|..+|++++.+++|+..++ ..++|++|.+++.+++++.++..+|+.++..|++++|+++|++++++..   .+
T Consensus      1062 lglyEEAf~IYkKa~~~~~A~~VLie~i~nldrAiE~Aervn~p~vWsqLAKAql~~G~~kEAIdsYiKAdD~say~eVa 1141 (1630)
T 1xi4_A         1062 NELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVV 1141 (1630)
T ss_pred             CCCHHHHHHHHHHcCCHHHHHHHHHHHHhhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCHHHHHHHHHhcCChHHHHHHH
Confidence            5899999999999999999988888 9999999999999999999999999999999999999999999998654   55


Q ss_pred             HHHhhccCCHHHHHHHHHh--------------------------------cCCHHHHHHHHHHHHhcCCHHHHHHHHHH
Q psy12373         82 RVDLDHLNDIRHAVDIVKA--------------------------------KKCTEGAKRIADYCNKHGDFGAAIHFLIL  129 (198)
Q Consensus        82 ~l~~~~~~~~~~a~~l~~~--------------------------------~~~~~~~~~~A~~~~~~g~~~~Av~~y~~  129 (198)
                      ..+. ++|+|++|++....                                .++......+|.+|.+.|++++|+.+|.+
T Consensus      1142 ~~~~-~lGkyEEAIeyL~mArk~~~e~~Idt~LafaYAKl~rleele~fI~~~n~ad~~~iGd~le~eg~YeeA~~~Y~k 1220 (1630)
T 1xi4_A         1142 QAAN-TSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNN 1220 (1630)
T ss_pred             HHHH-HcCCHHHHHHHHHHHHhhcccccccHHHHHHHHhhcCHHHHHHHHhCCCHHHHHHHHHHHHhcCCHHHHHHHHHh
Confidence            5666 78888888765522                                11222344688999999999999999999


Q ss_pred             cCChHHHHHHHHHcchhhHHhhh
Q psy12373        130 SKCYQDAFNLSQQHKKLHEFGKF  152 (198)
Q Consensus       130 ag~~~~A~~la~~~~~~~~~~~~  152 (198)
                      ++.|....+.....|.++...++
T Consensus      1221 A~ny~rLA~tLvkLge~q~AIEa 1243 (1630)
T 1xi4_A         1221 VSNFGRLASTLVHLGEYQAAVDG 1243 (1630)
T ss_pred             hhHHHHHHHHHHHhCCHHHHHHH
Confidence            98888877777777666544443



>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mzk_B Protein transport protein SEC16; alpha-helical-stack, beta-propeller; 2.69A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qil_A Clathrin heavy chain 1; clathrin trimerization domain, endocytosis, structural prote; 3.92A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mzk_B Protein transport protein SEC16; alpha-helical-stack, beta-propeller; 2.69A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.08
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.79
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.67
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.59
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.52
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.3
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.1
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.04
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.96
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.93
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.77
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.73
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.6
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.49
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.43
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.41
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.39
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.39
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.1
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 96.6
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.51
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.45
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.37
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.2
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.05
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 95.86
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.65
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.29
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.99
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 94.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.67
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 94.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.03
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.74
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.53
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 92.24
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 91.31
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 90.35
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 89.77
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 80.82
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.08  E-value=5e-09  Score=82.81  Aligned_cols=133  Identities=14%  Similarity=0.144  Sum_probs=86.7

Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHccCHHHHHhhhhccCC----hHHHHHHHHHHHHcCCHHHHHHHHHHhcCHHHHHHHH
Q psy12373          9 DRGKWTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKS----ATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVD   84 (198)
Q Consensus         9 ~~~Aa~~y~~~g~~~~Ai~~y~~~~~~~~a~~l~~~~~~----~~l~~~~A~~~e~~g~~~~A~~~Y~ka~~~~~av~l~   84 (198)
                      |.+|+.+|..+|++++|+++|.++      ..+..+..+    ...+...|..+...|++++|+++|.++      ++++
T Consensus        40 y~~aa~~y~~~~~~~~A~~~y~kA------~~~~~~~~~~~~~a~~~~~~g~~y~~~~~~~~A~~~~~~a------~~~~  107 (290)
T d1qqea_          40 CVQAATIYRLRKELNLAGDSFLKA------ADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENA------IQIF  107 (290)
T ss_dssp             HHHHHHHHHHTTCTHHHHHHHHHH------HHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHH------HHHH
T ss_pred             HHHHHHHHHHCcCHHHHHHHHHHH------HHHHHHcCCCHHHHHHHHHHHHHHHHhCCcHHHHHHHHHh------hHHh
Confidence            444444444555555555555444      333333333    246778899999999999999999888      8888


Q ss_pred             hhccCCHHHHHHHHHhcCCHHHHHHHHHHHHh-cCCHHHHHHHHHHcCChHHHHHHHHHcchhhHHhhhhhhcCCCCHHH
Q psy12373         85 LDHLNDIRHAVDIVKAKKCTEGAKRIADYCNK-HGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVE  163 (198)
Q Consensus        85 ~~~~~~~~~a~~l~~~~~~~~~~~~~A~~~~~-~g~~~~Av~~y~~ag~~~~A~~la~~~~~~~~~~~~~~l~~~~~~~~  163 (198)
                      . ..+++..+..+         ...+|..+.. .|++++|+++|.++      +.+....+...           .....
T Consensus       108 ~-~~~~~~~~~~~---------~~~l~~~~~~~~~~~~~A~~~~~~A------~~l~~~~~~~~-----------~~~~~  160 (290)
T d1qqea_         108 T-HRGQFRRGANF---------KFELGEILENDLHDYAKAIDCYELA------GEWYAQDQSVA-----------LSNKC  160 (290)
T ss_dssp             H-HTTCHHHHHHH---------HHHHHHHHHHTTCCHHHHHHHHHHH------HHHHHHTTCHH-----------HHHHH
T ss_pred             h-hcccchhHHHH---------HHHHHHhHhhHHHHHHHHHHHHHHH------HHHHHhcCchh-----------hhhhH
Confidence            8 77887765433         4467777765 58999999888664      44444333221           11245


Q ss_pred             HHHHHHHHHhCCChhhH
Q psy12373        164 LKRLAIHFEEDKGVLTS  180 (198)
Q Consensus       164 ~~~~A~~~e~~g~~~~A  180 (198)
                      +..+|..|...|+|.+|
T Consensus       161 ~~~la~~~~~~g~y~~A  177 (290)
T d1qqea_         161 FIKCADLKALDGQYIEA  177 (290)
T ss_dssp             HHHHHHHHHHTTCHHHH
T ss_pred             HHHHHHHHHHcChHHHH
Confidence            67778888888888777



>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure