Diaphorina citri psyllid: psy12389

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MKFELLLDLMHTLHIRTAQIYRWWADENPETEMSSLWSQGWCPLLQGIARLCCDTRKEPADSDLPLSKVSAPHPIINIVTQPQSYSISGSLDPGAPPQDGETIV
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHccccccccccHHHHHHccccHHccccccccHHHccccccccccccccccc
MKFELLLDLMHTLHIRTAQIYRWWADENPETEMSSLWSQGWCPLLQGIARLCCDTRKEPADSDLPLSKVSAPHPIINIVTQPQSYS******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFELLLDLMHTLHIRTAQIYRWWADENPETEMSSLWSQGWCPLLQGIARLCCDTRKEPADSDLPLSKVSAPHPIINIVTQPQSYSISGSLDPGAPPQDGETIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 Promotes guanine-nucleotide exchange on ARF5. Promotes the activation of ARF5 through replacement of GDP with GTP.confidentQ9R1D7
Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 Promotes guanine-nucleotide exchange on ARF5. Promotes the activation of ARF5 through replacement of GDP with GTP.confidentQ92538

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0002064 [BP]epithelial cell developmentprobableGO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0048468, GO:0009888, GO:0044767, GO:0044763, GO:0030855, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0032940 [BP]secretion by cellprobableGO:0046903, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0007431 [BP]salivary gland developmentprobableGO:0032502, GO:0035272, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0000137 [CC]Golgi cis cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0035149 [BP]lumen formation, open tracheal systemprobableGO:0032502, GO:0007424, GO:0035152, GO:0009653, GO:0035239, GO:0044707, GO:0008150, GO:0060541, GO:0048856, GO:0035148, GO:0044767, GO:0032501, GO:0065007, GO:0044699, GO:0048731, GO:0035295, GO:0065008, GO:0007275, GO:0048646
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted