Psyllid ID: psy12389
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| 242020495 | 1993 | golgi-specific brefeldin A-resistance gu | 0.509 | 0.026 | 0.792 | 2e-20 | |
| 328706091 | 1670 | PREDICTED: golgi-specific brefeldin A-re | 0.509 | 0.031 | 0.754 | 9e-19 | |
| 189240049 | 1786 | PREDICTED: similar to golgi-specific bre | 0.509 | 0.029 | 0.722 | 3e-17 | |
| 270011755 | 1742 | hypothetical protein TcasGA2_TC005830 [T | 0.509 | 0.030 | 0.722 | 3e-17 | |
| 347966090 | 2134 | AGAP001527-PA [Anopheles gambiae str. PE | 0.509 | 0.024 | 0.722 | 8e-16 | |
| 380021966 | 1894 | PREDICTED: LOW QUALITY PROTEIN: golgi-sp | 0.509 | 0.027 | 0.698 | 9e-16 | |
| 328786075 | 1869 | PREDICTED: golgi-specific brefeldin A-re | 0.509 | 0.028 | 0.698 | 1e-15 | |
| 383852794 | 1845 | PREDICTED: LOW QUALITY PROTEIN: golgi-sp | 0.509 | 0.028 | 0.679 | 2e-15 | |
| 321468534 | 1678 | hypothetical protein DAPPUDRAFT_197351 [ | 0.509 | 0.031 | 0.565 | 3e-15 | |
| 170029975 | 1868 | golgi-specific brefeldin a-resistance fa | 0.509 | 0.028 | 0.703 | 4e-15 |
| >gi|242020495|ref|XP_002430688.1| golgi-specific brefeldin A-resistance guanine nucleotide exchange factor, putative [Pediculus humanus corporis] gi|212515878|gb|EEB17950.1| golgi-specific brefeldin A-resistance guanine nucleotide exchange factor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 102 bits (255), Expect = 2e-20, Method: Compositional matrix adjust.
Identities = 42/53 (79%), Positives = 47/53 (88%)
Query: 6 LLDLMHTLHIRTAQIYRWWADENPETEMSSLWSQGWCPLLQGIARLCCDTRKE 58
LLDLMHTLH RTAQI+RWWA EN +T +SLW QGWCPLLQGIARLCCD+RK+
Sbjct: 1437 LLDLMHTLHTRTAQIFRWWAAENADTNFTSLWFQGWCPLLQGIARLCCDSRKQ 1489
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328706091|ref|XP_001948659.2| PREDICTED: golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189240049|ref|XP_967092.2| PREDICTED: similar to golgi-specific brefeldin a-resistance factor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270011755|gb|EFA08203.1| hypothetical protein TcasGA2_TC005830 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|347966090|ref|XP_321598.5| AGAP001527-PA [Anopheles gambiae str. PEST] gi|333470216|gb|EAA00837.5| AGAP001527-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|380021966|ref|XP_003694826.1| PREDICTED: LOW QUALITY PROTEIN: golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328786075|ref|XP_001123021.2| PREDICTED: golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383852794|ref|XP_003701910.1| PREDICTED: LOW QUALITY PROTEIN: golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|321468534|gb|EFX79518.1| hypothetical protein DAPPUDRAFT_197351 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|170029975|ref|XP_001842866.1| golgi-specific brefeldin a-resistance factor [Culex quinquefasciatus] gi|167865326|gb|EDS28709.1| golgi-specific brefeldin a-resistance factor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 104 | ||||||
| FB|FBgn0264560 | 1983 | garz "gartenzwerg" [Drosophila | 0.509 | 0.026 | 0.666 | 2.6e-14 | |
| RGD|1307160 | 1807 | Gbf1 "golgi brefeldin A resist | 0.509 | 0.029 | 0.532 | 1.1e-11 | |
| UNIPROTKB|F1NGJ3 | 1804 | GBF1 "Uncharacterized protein" | 0.509 | 0.029 | 0.564 | 3.4e-11 | |
| UNIPROTKB|F1PB58 | 1820 | GBF1 "Uncharacterized protein" | 0.509 | 0.029 | 0.532 | 1.2e-10 | |
| UNIPROTKB|F1PB51 | 1857 | GBF1 "Uncharacterized protein" | 0.509 | 0.028 | 0.532 | 1.2e-10 | |
| UNIPROTKB|Q92538 | 1859 | GBF1 "Golgi-specific brefeldin | 0.509 | 0.028 | 0.532 | 1.2e-10 | |
| UNIPROTKB|E1BMC4 | 1861 | GBF1 "Uncharacterized protein" | 0.509 | 0.028 | 0.532 | 1.2e-10 | |
| UNIPROTKB|F1S8S9 | 1865 | GBF1 "Uncharacterized protein" | 0.509 | 0.028 | 0.532 | 1.2e-10 | |
| ZFIN|ZDB-GENE-081107-54 | 1786 | si:dkey-183c23.1 "si:dkey-183c | 0.509 | 0.029 | 0.507 | 3.8e-10 | |
| UNIPROTKB|H8ESE7 | 485 | gbf-1 "Protein GBF-1, isoform | 0.5 | 0.107 | 0.403 | 5.5e-07 |
| FB|FBgn0264560 garz "gartenzwerg" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 193 (73.0 bits), Expect = 2.6e-14, Sum P(2) = 2.6e-14
Identities = 36/54 (66%), Positives = 42/54 (77%)
Query: 6 LLDLMHTLHIRTAQIYRWWADENPETEMSS-LWSQGWCPLLQGIARLCCDTRKE 58
LLDLM+TL+ RTAQI+RWWA+E S+ LWS GWCPLLQGIARL D R+E
Sbjct: 1449 LLDLMYTLYTRTAQIFRWWAEEGCTVPQSAALWSPGWCPLLQGIARLAMDRRRE 1502
|
|
| RGD|1307160 Gbf1 "golgi brefeldin A resistant guanine nucleotide exchange factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGJ3 GBF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PB58 GBF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PB51 GBF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92538 GBF1 "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BMC4 GBF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8S9 GBF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081107-54 si:dkey-183c23.1 "si:dkey-183c23.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H8ESE7 gbf-1 "Protein GBF-1, isoform b" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 104 | |||
| KOG0928|consensus | 1386 | 97.62 | ||
| PLN03076 | 1780 | ARF guanine nucleotide exchange factor (ARF-GEF); | 96.72 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 85.92 |
| >KOG0928|consensus | Back alignment and domain information |
|---|
Probab=97.62 E-value=1.8e-05 Score=75.02 Aligned_cols=51 Identities=20% Similarity=0.184 Sum_probs=43.7
Q ss_pred hhhhhhhhHHHHHHHhhhcCCCchhhhhhhhhccccCCcchhhhcCCCceee
Q psy12389 35 SLWSQGWCPLLQGIARLCCDTRKEPADSDLPLSKVSAPHPIINIVTQPQSYS 86 (104)
Q Consensus 35 ~lWs~~W~PLLqgiarqC~d~rReVR~~Ait~LQRsLLsPeL~~l~~~~~~s 86 (104)
..=+..|+||++++.++|+|.||+||++|+++||| ++....+-+.++.|.+
T Consensus 1181 ~~~~~~wl~l~~~~~kl~L~~r~~vRn~aL~~lqr-~~~~~~q~l~~~~~~~ 1231 (1386)
T KOG0928|consen 1181 NYRSEIWLILLQIIRKLCLLSRRGVRNAALTKLQR-IIGALDQGLAHSYWNP 1231 (1386)
T ss_pred hhhHHHHHHHHHHhhhcchhhhhhhHHHHHHHHHH-HHHhhhcccchHHHHH
Confidence 33333999999999999999999999999999999 4777778888877765
|
|
| >PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00