Diaphorina citri psyllid: psy12414


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESKVEHYRVKYKEAHLTIDDEEFFENLAQLV
cccccccHHHHHHHcccccccCEEEEEcccccccEEEEEEccEEEEEEEEEcccEEECccccccccHHHcc
WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESKVEHYRVKYKEAHLTIDDEEFFENLAQLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESKVEHYRVKYKEAHLTIDDEEFFENLAQLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.confidentP32577
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs). Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane.confidentP41239
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.confidentQ0VBZ0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048709 [BP]oligodendrocyte differentiationprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0010001, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0070064 [MF]proline-rich region bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0007169 [BP]transmembrane receptor protein tyrosine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0033673 [BP]negative regulation of kinase activityprobableGO:0042325, GO:0051348, GO:0019220, GO:0019222, GO:0050790, GO:0031323, GO:0051338, GO:0050789, GO:0051174, GO:0065007, GO:0043549, GO:0044092, GO:0008150, GO:0065009, GO:0050794, GO:0043086
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0032715 [BP]negative regulation of interleukin-6 productionprobableGO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032675, GO:0001818
GO:0043406 [BP]positive regulation of MAP kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0001932, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0071375 [BP]cellular response to peptide hormone stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0008150, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0044763, GO:1901698
GO:0070373 [BP]negative regulation of ERK1 and ERK2 cascadeprobableGO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0010741, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048523, GO:0010646, GO:0010627, GO:0070372, GO:0043409, GO:0043408
GO:0005070 [MF]SH3/SH2 adaptor activityprobableGO:0030674, GO:0035591, GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0080134 [BP]regulation of response to stressprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0050851 [BP]antigen receptor-mediated signaling pathwayprobableGO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045779 [BP]negative regulation of bone resorptionprobableGO:0034103, GO:0034104, GO:0051241, GO:0045124, GO:0032844, GO:0008150, GO:0046851, GO:0046850, GO:0065007, GO:0032845, GO:0051239, GO:0048519, GO:0050789
GO:0010989 [BP]negative regulation of low-density lipoprotein particle clearanceprobableGO:0010988, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0010984, GO:0010985, GO:0050789
GO:0043235 [CC]receptor complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0050765 [BP]negative regulation of phagocytosisprobableGO:0050764, GO:0032879, GO:0051051, GO:0050794, GO:0051049, GO:0008150, GO:0009987, GO:0051129, GO:0060627, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0045806, GO:0030100, GO:0050789, GO:0048523
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0010669 [BP]epithelial structure maintenanceprobableGO:0032501, GO:0048871, GO:0044707, GO:0060249, GO:0042592, GO:0008150, GO:0065007, GO:0001894, GO:0065008, GO:0044699
GO:0019903 [MF]protein phosphatase bindingprobableGO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0060368 [BP]regulation of Fc receptor mediated stimulatory signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0008150, GO:0002682, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0007293 [BP]germarium-derived egg chamber formationprobableGO:0032502, GO:0007292, GO:0044702, GO:0000003, GO:0032504, GO:0022414, GO:0048856, GO:0019953, GO:0044767, GO:0003006, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0009653, GO:0048477, GO:0048646, GO:0048609
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0031324 [BP]negative regulation of cellular metabolic processprobableGO:0009892, GO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0004713 [MF]protein tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0017124 [MF]SH3 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042997 [BP]negative regulation of Golgi to plasma membrane protein transportprobableGO:0033157, GO:0070201, GO:0051223, GO:0060341, GO:0051051, GO:0051049, GO:0032386, GO:0032387, GO:0090317, GO:0050794, GO:0008150, GO:0065007, GO:0042996, GO:0048519, GO:0032879, GO:0060627, GO:0051224, GO:0050789, GO:0048523, GO:0032880
GO:0043068 [BP]positive regulation of programmed cell deathprobableGO:0050794, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0016791 [MF]phosphatase activityprobableGO:0042578, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0034334 [BP]adherens junction maintenanceprobableGO:0009987, GO:0034332, GO:0034331, GO:0034330, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0043954, GO:0008150, GO:0044699
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0045197 [BP]establishment or maintenance of epithelial cell apical/basal polarityprobableGO:0035088, GO:0061245, GO:0009987, GO:0007163, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EAZ, chain A
Confidence level:very confident
Coverage over the Query: 1-71
View the alignment between query and template
View the model in PyMOL