Diaphorina citri psyllid: psy12421

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MALRVFEPRSLRYPQDNPRLRTRAIPKTIPAYVPEVQQVRRREPLQITFWQETVESAPNFTFLLRPRVMQVRQTCKLLCCLSGKPPPTVKWYKGNRELSKRDYSMSYSDGVVSMEIIDCKPEDSGEYKCVATNKHGTDETNCVVIVESEEESKEQQELAHNFLYSGEQ
ccccccccccccccccccCEEEECcccccccccccCEEECccccccccccccccccccCEECccccEEEcccccEEEEEEEEECcccEEEEEEccEEcccccEEEEEEccEEEEEEccccccccCEEEEEEEccccCEEEEEEEEEEcccccHHHHHccccccccccc
*A*R******************************************ITFWQETVESAPNFTFLLRPRVMQVRQTCKLLCCLSGKPPPTVKWYKGNRELSKRDYSMSYSDGVVSMEIIDCKPEDSGEYKCVATNKHGTDETNCVVIV**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRVFEPRSLRYPQDNPRLRTRAIPKTIPAYVPEVQQVRRREPLQITFWQETVESAPNFTFLLRPRVMQVRQTCKLLCCLSGKPPPTVKWYKGNRELSKRDYSMSYSDGVVSMEIIDCKPEDSGEYKCVATNKHGTDETNCVVIVESEEESKEQQELAHNFLYSGEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0032989 [BP]cellular component morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0051592 [BP]response to calcium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 55-151
View the alignment between query and template
View the model in PyMOL
Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 17-149
View the alignment between query and template
View the model in PyMOL
Template: 1E07, chain A
Confidence level:very confident
Coverage over the Query: 15-167
View the alignment between query and template
View the model in PyMOL