Diaphorina citri psyllid: psy12429


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHLKVL
ccHHHHHHHHHHHcccccccccccccHHHHHcccccHHHcccccccEEccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHcccccccEEEEEcccCCccccccccccccccccEEEEEccccccccccEEECccHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccHHHHccc
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACL***************SSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIE************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAFDAFIKMxxxxxxxxxxxxxxxxxxxxxAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHLKVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent histone deacetylase Sir2 NAD-dependent histone deacetylase involved in heterochromatic silencing. Mildly suppresses the heterochromatin-mediated silencing phenomenon known as position-effect variegation (PEV). Required for epigenetic silencing of the polycomb group proteins. Has histone H4 deacetylase activity in vitro. Required maternally for establishing proper segmentation of the embryo. Involved in sex determination. May be involved in the regulation of life span.confidentQ9VK34

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0004407 [MF]histone deacetylase activityprobableGO:0016787, GO:0019213, GO:0016810, GO:0016811, GO:0003824, GO:0003674, GO:0033558
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0016575 [BP]histone deacetylationprobableGO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HJH, chain A
Confidence level:very confident
Coverage over the Query: 2-81,95-199
View the alignment between query and template
View the model in PyMOL
Template: 3PKI, chain A
Confidence level:very confident
Coverage over the Query: 2-79,97-198
View the alignment between query and template
View the model in PyMOL