Psyllid ID: psy12429

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHLKVL
ccHHHHHHHHHHHcccccccccccccHHHHHcccccHHHcccccccEEcccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHccccccEEEEEcccEEccccccccccccccccEEEEEccccccccccEEEEccHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccHHHHccc
cHHHHHHHHHHHHcccEEEEEEcccccHHHHcccccEEEccEEEEEEEEcccccEEEcccHHHHHHHcccccccccccccccccccccHcccccccccccccccEEEEEEccEccccccHHHHHHccccccccEEEEEcccccccccHHHHccccccccEEEEEccccccccccEEEcccHHHHHHHHHHHHcccHHHHHHHHHcccccccccHcccHHHHHHHcHHHHHHccccEHHHHHHHHHccccEEEEEEEEccccHHHHHcc
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHgsfatasctrcghrvsaeaIKADVfqqriplcpspaclssptssdisvpagessslpptpsrgvmkpdivffgeglpdsfhsamtldknRCDLLIVIGsslkvrpvalipnslppsvpqilinrerlshlnfdvellgdgdVIIDTLCRALGESWTGTLLELYnslppsvpqilinrerlshlnfdvellgdgdVIIDTLCRALGESWTVRLKIekvssprehlkvl
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAgessslpptpsrgVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALgeswtvrlkiekvssprehlkvl
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIplcpspaclssptssDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHLKVL
**AFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCP**********************************DIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIE************
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTL********************************************************************
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPA***********************PSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKV**********
MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACL***************SSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAFDAFIKMxxxxxxxxxxxxxxxxxxxxxAGIENVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTGTLLELYNSLPPSVPQILINRERLSHLNFDVELLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHLKVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query268 2.2.26 [Sep-21-2011]
Q9VK34 823 NAD-dependent histone dea yes N/A 0.694 0.226 0.642 5e-64
Q96EB6 747 NAD-dependent protein dea no N/A 0.634 0.227 0.581 2e-56
Q923E4 737 NAD-dependent protein dea no N/A 0.634 0.230 0.575 4e-56
Q21921 607 NAD-dependent protein dea yes N/A 0.649 0.286 0.482 2e-46
Q60L58 602 NAD-dependent protein dea N/A N/A 0.611 0.272 0.489 1e-44
C8V3W5489 NAD-dependent protein dea yes N/A 0.690 0.378 0.433 3e-43
Q5AQ47657 NAD-dependent protein dea N/A N/A 0.712 0.290 0.436 4e-42
Q6FWI7509 NAD-dependent histone dea yes N/A 0.738 0.388 0.427 6e-41
P53685503 NAD-dependent protein dea yes N/A 0.671 0.357 0.476 3e-40
Q757M7559 NAD-dependent histone dea yes N/A 0.712 0.341 0.447 4e-40
>sp|Q9VK34|SIR2_DROME NAD-dependent histone deacetylase Sir2 OS=Drosophila melanogaster GN=Sir2 PE=1 SV=1 Back     alignment and function desciption
 Score =  244 bits (623), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 147/190 (77%), Gaps = 4/190 (2%)

Query: 7   FIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVF 66
           FIKMLE  GKLLRNY+QNIDTLE+VAGI+ VIECHGSF+TASCT+C  + +A+A++AD+F
Sbjct: 297 FIKMLETKGKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTKCRFKCNADALRADIF 356

Query: 67  QQRIPLCPSPACLSSPTSS-DISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAM 125
            QRIP+CP   C  +   S D SV   E   L      G+MKPDIVFFGEGLPD +H+ M
Sbjct: 357 AQRIPVCPQ--CQPNKEQSVDASVAVTEEE-LRQLVENGIMKPDIVFFGEGLPDEYHTVM 413

Query: 126 TLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVII 185
             DK+ CDLLIVIGSSLKVRPVA IP+S+P +VPQILINRE+L HL FDVELLGD DVII
Sbjct: 414 ATDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINREQLHHLKFDVELLGDSDVII 473

Query: 186 DTLCRALGES 195
           + +C  L ++
Sbjct: 474 NQICHRLSDN 483
NAD-dependent histone deacetylase involved in heterochromatic silencing. Mildly suppresses the heterochromatin-mediated silencing phenomenon known as position-effect variegation (PEV). Required for epigenetic silencing of the polycomb group proteins. Has histone H4 deacetylase activity in vitro. Required maternally for establishing proper segmentation of the embryo. Involved in sex determination. May be involved in the regulation of life span.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: -
>sp|Q96EB6|SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens GN=SIRT1 PE=1 SV=2 Back     alignment and function description
>sp|Q923E4|SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus GN=Sirt1 PE=1 SV=2 Back     alignment and function description
>sp|Q21921|SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans GN=sir-2.1 PE=1 SV=1 Back     alignment and function description
>sp|Q60L58|SIR2_CAEBR NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis briggsae GN=sir-2.1 PE=3 SV=1 Back     alignment and function description
>sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 Back     alignment and function description
>sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 Back     alignment and function description
>sp|P53685|HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST1 PE=1 SV=1 Back     alignment and function description
>sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
193652531 583 PREDICTED: NAD-dependent deacetylase sir 0.626 0.288 0.685 1e-68
328790115 884 PREDICTED: hypothetical protein LOC41191 0.716 0.217 0.651 3e-68
328790113 892 PREDICTED: hypothetical protein LOC41191 0.716 0.215 0.651 3e-68
380011705 849 PREDICTED: uncharacterized protein LOC10 0.716 0.226 0.651 1e-67
383850442 892 PREDICTED: uncharacterized protein LOC10 0.746 0.224 0.631 3e-67
332022373 854 NAD-dependent deacetylase sirtuin-1 [Acr 0.757 0.237 0.622 4e-67
350419531 890 PREDICTED: NAD-dependent deacetylase sir 0.742 0.223 0.625 1e-66
350419529 898 PREDICTED: NAD-dependent deacetylase sir 0.742 0.221 0.625 1e-66
156550151 871 PREDICTED: hypothetical protein LOC10012 0.735 0.226 0.617 1e-66
307186885 775 NAD-dependent deacetylase sirtuin-1 [Cam 0.694 0.24 0.657 2e-66
>gi|193652531|ref|XP_001943036.1| PREDICTED: NAD-dependent deacetylase sirtuin-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/191 (68%), Positives = 145/191 (75%), Gaps = 23/191 (12%)

Query: 7   FIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVF 66
           FIK+LE+ G+LLRNY+QNIDTLEQV GI NVIECHGSFATASCT+CGH+VSAE I+ DVF
Sbjct: 279 FIKVLEKKGRLLRNYTQNIDTLEQVVGINNVIECHGSFATASCTQCGHKVSAETIRPDVF 338

Query: 67  QQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMT 126
           +QRIP CP   C++S                      G+MKPDIVFFGEGLPDSFH A+ 
Sbjct: 339 EQRIPRCP--ICVNS---------------------TGIMKPDIVFFGEGLPDSFHKAIE 375

Query: 127 LDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIID 186
            DKN CDLLIVIGSSLKVRPVA IPN L   VPQILINRERL H+NFDVELLGD DVI+D
Sbjct: 376 DDKNNCDLLIVIGSSLKVRPVARIPNMLDKHVPQILINRERLPHMNFDVELLGDSDVIVD 435

Query: 187 TLCRALGESWT 197
            LCR LG  WT
Sbjct: 436 HLCRMLGSDWT 446

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328790115|ref|XP_003251380.1| PREDICTED: hypothetical protein LOC411917 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|328790113|ref|XP_395386.3| PREDICTED: hypothetical protein LOC411917 isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380011705|ref|XP_003689938.1| PREDICTED: uncharacterized protein LOC100863714 [Apis florea] Back     alignment and taxonomy information
>gi|383850442|ref|XP_003700804.1| PREDICTED: uncharacterized protein LOC100881811 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332022373|gb|EGI62685.1| NAD-dependent deacetylase sirtuin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350419531|ref|XP_003492216.1| PREDICTED: NAD-dependent deacetylase sirtuin-1-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350419529|ref|XP_003492215.1| PREDICTED: NAD-dependent deacetylase sirtuin-1-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|156550151|ref|XP_001606126.1| PREDICTED: hypothetical protein LOC100122518 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307186885|gb|EFN72286.1| NAD-dependent deacetylase sirtuin-1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
FB|FBgn0024291 823 Sir2 "Sir2" [Drosophila melano 0.697 0.227 0.619 3.7e-56
UNIPROTKB|F1N886 601 SIRT1 "Uncharacterized protein 0.399 0.178 0.675 2.2e-53
UNIPROTKB|B0QZ35 444 SIRT1 "SirtT1 75 kDa fragment" 0.358 0.216 0.697 3.7e-52
UNIPROTKB|E9PC49 452 SIRT1 "SirtT1 75 kDa fragment" 0.358 0.212 0.697 3.7e-52
ZFIN|ZDB-GENE-070801-2 710 sirt1 "sirtuin (silent mating 0.365 0.138 0.679 1.5e-51
RGD|1308542 589 Sirt1 "sirtuin 1" [Rattus norv 0.358 0.162 0.697 6.1e-51
UNIPROTKB|F1LTP2 628 F1LTP2 "Uncharacterized protei 0.358 0.152 0.697 1e-50
UNIPROTKB|F1SUJ0639 SIRT1 "Uncharacterized protein 0.358 0.150 0.697 1.1e-50
UNIPROTKB|F1MQB8 734 SIRT1 "Uncharacterized protein 0.358 0.130 0.697 2.6e-50
UNIPROTKB|E2RE73 745 SIRT1 "Uncharacterized protein 0.358 0.128 0.697 2.8e-50
FB|FBgn0024291 Sir2 "Sir2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 579 (208.9 bits), Expect = 3.7e-56, P = 3.7e-56
 Identities = 117/189 (61%), Positives = 140/189 (74%)

Query:     7 FIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVF 66
             FIKMLE  GKLLRNY+QNIDTLE+VAGI+ VIECHGSF+TASCT+C  + +A+A++AD+F
Sbjct:   297 FIKMLETKGKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTKCRFKCNADALRADIF 356

Query:    67 QQRIXXXXXXXXXXXXXXXDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMT 126
              QRI               D SV   E   L      G+MKPDIVFFGEGLPD +H+ M 
Sbjct:   357 AQRIPVCPQCQPNKEQSV-DASVAVTEEE-LRQLVENGIMKPDIVFFGEGLPDEYHTVMA 414

Query:   127 LDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIID 186
              DK+ CDLLIVIGSSLKVRPVA IP+S+P +VPQILINRE+L HL FDVELLGD DVII+
Sbjct:   415 TDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINREQLHHLKFDVELLGDSDVIIN 474

Query:   187 TLCRALGES 195
              +C  L ++
Sbjct:   475 QICHRLSDN 483
GO:0017136 "NAD-dependent histone deacetylase activity" evidence=ISS;IDA
GO:0004407 "histone deacetylase activity" evidence=IDA
GO:0016575 "histone deacetylation" evidence=IDA
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0007584 "response to nutrient" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0070403 "NAD+ binding" evidence=IEA
GO:0006342 "chromatin silencing" evidence=IMP
GO:0005654 "nucleoplasm" evidence=IDA
GO:0035065 "regulation of histone acetylation" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IDA
GO:0042981 "regulation of apoptotic process" evidence=IMP
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0008134 "transcription factor binding" evidence=IPI
UNIPROTKB|F1N886 SIRT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZ35 SIRT1 "SirtT1 75 kDa fragment" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PC49 SIRT1 "SirtT1 75 kDa fragment" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070801-2 sirt1 "sirtuin (silent mating type information regulation 2 homolog) 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1308542 Sirt1 "sirtuin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTP2 F1LTP2 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUJ0 SIRT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQB8 SIRT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE73 SIRT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VK34SIR2_DROME3, ., 5, ., 1, ., -0.64210.69400.2260yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
cd01408235 cd01408, SIRT1, SIRT1: Eukaryotic group (class1) w 6e-78
cd01407218 cd01407, SIR2-fam, SIR2 family of proteins include 4e-55
pfam02146177 pfam02146, SIR2, Sir2 family 2e-51
COG0846250 COG0846, SIR2, NAD-dependent protein deacetylases, 5e-40
cd00296222 cd00296, SIR2, SIR2 superfamily of proteins includ 6e-39
PTZ00410349 PTZ00410, PTZ00410, NAD-dependent SIR2; Provisiona 2e-30
PRK00481242 PRK00481, PRK00481, NAD-dependent deacetylase; Pro 2e-27
cd01413222 cd01413, SIR2_Af2, SIR2_Af2: Archaeal and prokaryo 4e-27
PRK14138244 PRK14138, PRK14138, NAD-dependent deacetylase; Pro 7e-22
cd01409260 cd01409, SIRT4, SIRT4: Eukaryotic and prokaryotic 8e-19
cd01412224 cd01412, SIRT5_Af1_CobB, SIRT5_Af1_CobB: Eukaryoti 1e-18
cd01410206 cd01410, SIRT7, SIRT7: Eukaryotic and prokaryotic 3e-17
PTZ00409271 PTZ00409, PTZ00409, Sir2 (Silent Information Regul 8e-16
PRK05333285 PRK05333, PRK05333, NAD-dependent deacetylase; Pro 1e-15
cd01411225 cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic 4e-15
PTZ00408242 PTZ00408, PTZ00408, NAD-dependent deacetylase; Pro 3e-07
>gnl|CDD|238699 cd01408, SIRT1, SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information 
 Score =  235 bits (601), Expect = 6e-78
 Identities = 90/188 (47%), Positives = 113/188 (60%), Gaps = 31/188 (16%)

Query: 6   AFIKMLERHGKLLRNYSQNIDTLEQVAGIEN--VIECHGSFATASCTRCGHRVSAEAIKA 63
            FIK+LE  G LLRNY+QNIDTLE+VAG+ +  +IE HGSFATA C +C H+   + ++ 
Sbjct: 74  YFIKLLEDKGLLLRNYTQNIDTLERVAGVPDDRIIEAHGSFATAHCIKCKHKYPGDWMRE 133

Query: 64  DVFQQRIPLCPSPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHS 123
           D+F Q +P CP   C                         G++KPDIVFFGE LP  F S
Sbjct: 134 DIFNQEVPKCPR--C------------------------GGLVKPDIVFFGESLPSRFFS 167

Query: 124 AMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLN---FDVELLGD 180
            M  DK   DLLIVIG+SLKV P A +P+ +P  VP++LINRE + HL    FDV LLGD
Sbjct: 168 HMEEDKEEADLLIVIGTSLKVAPFASLPSRVPSEVPRVLINREPVGHLGKRPFDVALLGD 227

Query: 181 GDVIIDTL 188
            D  +  L
Sbjct: 228 CDDGVREL 235

Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity. Length = 235
>gnl|CDD|238698 cd01407, SIR2-fam, SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>gnl|CDD|216902 pfam02146, SIR2, Sir2 family Back     alignment and domain information
>gnl|CDD|223915 COG0846, SIR2, NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>gnl|CDD|238184 cd00296, SIR2, SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>gnl|CDD|185600 PTZ00410, PTZ00410, NAD-dependent SIR2; Provisional Back     alignment and domain information
>gnl|CDD|234777 PRK00481, PRK00481, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238704 cd01413, SIR2_Af2, SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|172627 PRK14138, PRK14138, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238700 cd01409, SIRT4, SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|238703 cd01412, SIRT5_Af1_CobB, SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>gnl|CDD|238701 cd01410, SIRT7, SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|173599 PTZ00409, PTZ00409, Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>gnl|CDD|235415 PRK05333, PRK05333, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238702 cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|240405 PTZ00408, PTZ00408, NAD-dependent deacetylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 268
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 100.0
PRK14138244 NAD-dependent deacetylase; Provisional 100.0
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla 100.0
PTZ00410349 NAD-dependent SIR2; Provisional 100.0
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 fami 100.0
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla 100.0
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 100.0
cd01413222 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group 100.0
KOG2682|consensus314 100.0
PRK05333285 NAD-dependent deacetylase; Provisional 100.0
KOG2684|consensus412 100.0
PTZ00408242 NAD-dependent deacetylase; Provisional 100.0
PRK00481242 NAD-dependent deacetylase; Provisional 100.0
cd01407218 SIR2-fam SIR2 family of proteins includes silent i 100.0
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 100.0
cd01411225 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homo 100.0
PF02146178 SIR2: Sir2 family; InterPro: IPR003000 These seque 100.0
KOG2683|consensus305 100.0
cd00296222 SIR2 SIR2 superfamily of proteins includes silent 100.0
KOG1905|consensus353 100.0
KOG2684|consensus412 98.71
KOG2682|consensus314 98.18
PTZ00410349 NAD-dependent SIR2; Provisional 96.98
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 96.6
cd01406242 SIR2-like Sir2-like: Prokaryotic group of uncharac 94.81
KOG1185|consensus 571 94.59
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 94.29
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 94.14
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 93.9
PRK07524 535 hypothetical protein; Provisional 93.86
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 93.84
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 93.64
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 93.61
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 93.6
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 93.58
PRK08322 547 acetolactate synthase; Reviewed 93.56
PRK05858 542 hypothetical protein; Provisional 93.49
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 93.39
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 93.35
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 93.27
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 93.23
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 93.15
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 93.11
PRK06154 565 hypothetical protein; Provisional 92.86
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 92.78
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 92.78
PRK08327 569 acetolactate synthase catalytic subunit; Validated 92.64
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 92.59
PLN02470 585 acetolactate synthase 92.5
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 92.44
PRK08266 542 hypothetical protein; Provisional 92.14
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 92.03
PRK06112 578 acetolactate synthase catalytic subunit; Validated 92.02
PRK11269 591 glyoxylate carboligase; Provisional 91.96
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 91.9
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 91.82
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 91.73
PRK08611 576 pyruvate oxidase; Provisional 91.61
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 91.47
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 91.41
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 91.38
PRK08155 564 acetolactate synthase catalytic subunit; Validated 91.38
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 91.2
PRK07092 530 benzoylformate decarboxylase; Reviewed 91.16
PRK08273 597 thiamine pyrophosphate protein; Provisional 90.53
PRK06546 578 pyruvate dehydrogenase; Provisional 90.48
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 90.36
PRK07064 544 hypothetical protein; Provisional 89.46
PRK09124 574 pyruvate dehydrogenase; Provisional 89.41
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 89.07
PRK08617 552 acetolactate synthase; Reviewed 88.81
PRK08199 557 thiamine pyrophosphate protein; Validated 88.76
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 87.58
PRK03363313 fixB putative electron transfer flavoprotein FixB; 87.53
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 86.96
COG3962 617 Acetolactate synthase [Amino acid transport and me 86.81
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 86.69
PLN02573 578 pyruvate decarboxylase 82.53
PRK06457 549 pyruvate dehydrogenase; Provisional 82.26
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 81.33
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information 
Probab=100.00  E-value=7.8e-46  Score=328.51  Aligned_cols=161  Identities=56%  Similarity=0.964  Sum_probs=147.9

Q ss_pred             CHHHHHHHHHHHcCCcceeEecCccchHhhcCCC--CeEeeccccceeeeCCCCceechHHHHHHHhhCCCCCCCCCCCC
Q psy12429          2 YAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIE--NVIECHGSFATASCTRCGHRVSAEAIKADVFQQRIPLCPSPACL   79 (268)
Q Consensus         2 ~~~H~~La~L~~~g~l~~viTQNIDgLh~~AG~~--~vielHG~l~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~~~C~   79 (268)
                      +++|++|++|+++|++.++|||||||||+|||++  +|+|||||+++.+|+.|++.|+++.+...+....+|.|+  .|+
T Consensus        70 n~~H~~la~L~~~g~~~~viTQNiD~Lh~raG~~~~~V~elHG~l~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~--~Cg  147 (235)
T cd01408          70 SVAHYFIKLLEDKGLLLRNYTQNIDTLERVAGVPDDRIIEAHGSFATAHCIKCKHKYPGDWMREDIFNQEVPKCP--RCG  147 (235)
T ss_pred             CHHHHHHHHHHhcCCceEEEEeccchHHHHcCCCccCEEEeCcCCCccccccCCCcCCHHHHHHHHhCCCCccCC--CCC
Confidence            6899999999999999999999999999999975  999999999999999999999988776665555579999  897


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCcccCcEEEcCCCCCHHHHHHHHHhhhcCCeEEEEccCCcccccccccccCCCCCC
Q psy12429         80 SSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVP  159 (268)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~g~lrP~Iv~FgE~~p~~~~~~~~~~~~~aDlllviGTSl~V~p~~~l~~~~~~g~~  159 (268)
                                              |.|||+||||||++|+..++++.+++++||++|||||||+|+|++.|+..+++|++
T Consensus       148 ------------------------g~lrP~Vv~FGE~lp~~~~~~~~~~~~~aDlllvvGTSl~V~pa~~l~~~~~~~~~  203 (235)
T cd01408         148 ------------------------GLVKPDIVFFGESLPSRFFSHMEEDKEEADLLIVIGTSLKVAPFASLPSRVPSEVP  203 (235)
T ss_pred             ------------------------CCccCcEEECCCCCCHHHHHHHHHHHhcCCEEEEECCCCeeccHHHHHHHHhCCCc
Confidence                                    99999999999999998888888889999999999999999999999988778899


Q ss_pred             EEEEeeccCCCC---cccchhcCCchHHHHHH
Q psy12429        160 QILINRERLSHL---NFDVELLGDGDVIIDTL  188 (268)
Q Consensus       160 ~i~IN~~~t~~~---~~dl~i~g~aD~vl~~L  188 (268)
                      +|+||++++..+   .+|++|+|+|+++|++|
T Consensus       204 ~v~iN~~~~~~~~~~~~d~~~~~~~~~~l~~~  235 (235)
T cd01408         204 RVLINREPVGHLGKRPFDVALLGDCDDGVREL  235 (235)
T ss_pred             EEEEeCCCCCCCCCCCcCEEEeCCHHHHHHhC
Confidence            999999999864   58999999999999864

Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PTZ00410 NAD-dependent SIR2; Provisional Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>KOG2682|consensus Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>KOG2684|consensus Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PF02146 SIR2: Sir2 family; InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases Back     alignment and domain information
>KOG2683|consensus Back     alignment and domain information
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>KOG1905|consensus Back     alignment and domain information
>KOG2684|consensus Back     alignment and domain information
>KOG2682|consensus Back     alignment and domain information
>PTZ00410 NAD-dependent SIR2; Provisional Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd01406 SIR2-like Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>KOG1185|consensus Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
4i5i_A287 Crystal Structure Of The Sirt1 Catalytic Domain Bou 1e-54
4iao_A492 Crystal Structure Of Sir2 C543s Mutant In Complex W 2e-37
2hjh_A354 Crystal Structure Of The Sir2 Deacetylase Length = 6e-37
4fvt_A274 Human Sirt3 Bound To Ac-Acs Peptide And Carba-Nad L 1e-24
3glr_A285 Crystal Structure Of Human Sirt3 With Acetyl-Lysine 1e-24
4hd8_A284 Crystal Structure Of Human Sirt3 In Complex With Fl 1e-24
1j8f_A323 Human Sirt2 Histone Deacetylase Length = 323 2e-23
1j8f_C323 Human Sirt2 Histone Deacetylase Length = 323 2e-23
1szc_A297 Structural Basis For Nicotinamide Cleavage And Adp- 8e-16
1q1a_A289 Structure Of The Yeast Hst2 Protein Deacetylase In 8e-16
1q17_A300 Structure Of The Yeast Hst2 Protein Deacetylase In 9e-16
2od7_A308 Crystal Structure Of Yhst2 Bound To The Intermediat 1e-15
1q14_A361 Structure And Autoregulation Of The Yeast Hst2 Homo 1e-15
2od2_A308 Crystal Structure Of Yhst2 I117f Mutant Bound To Ca 3e-15
1yc5_A246 Sir2-P53 Peptide-Nicotinamide Length = 246 1e-11
4g1c_A267 Human Sirt5 Bound To Succ-Idh2 And Carba-Nad Length 2e-11
4hda_A275 Crystal Structure Of Human Sirt5 In Complex With Fl 2e-11
2nyr_A271 Crystal Structure Of Human Sirtuin Homolog 5 In Com 2e-11
3rig_A273 Sirt5 Is An Nad-Dependent Protein Lysine Demalonyla 2e-11
2h4h_A246 Sir2 H116y Mutant-P53 Peptide-Nad Length = 246 4e-11
2b4y_A271 Crystal Structure Of Human Sirtuin Homolog 5 Length 4e-11
2h59_A246 Sir2 H116a-Deacetylated P53 Peptide-3'-O-Acetyl Adp 1e-10
1m2h_A249 Sir2 Homologue S24a Mutant-adp Ribose Complex Lengt 2e-09
1m2g_A249 Sir2 Homologue-Adp Ribose Complex Length = 249 2e-09
1ici_A256 Crystal Structure Of A Sir2 Homolog-Nad Complex Len 2e-09
1m2j_A249 Sir2 Homologue H80n Mutant-Adp Ribose Complex Lengt 3e-09
1m2n_A249 Sir2 Homologues (D102gF159AR170A) MUTANT-2'-O-Acety 5e-09
1ma3_A253 Structure Of A Sir2 Enzyme Bound To An Acetylated P 2e-08
1m2k_A249 Sir2 Homologue F159a Mutant-Adp Ribose Complex Leng 2e-08
3jwp_A265 Crystal Structure Of Plasmodium Falciparum Sir2a (P 8e-07
3u31_A290 Plasmodium Falciparum Sir2a Preferentially Hydrolyz 8e-07
>pdb|4I5I|A Chain A, Crystal Structure Of The Sirt1 Catalytic Domain Bound To Nad And An Ex527 Analog Length = 287 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (533), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/191 (56%), Positives = 131/191 (68%), Gaps = 21/191 (10%)
Query: 7   FIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEAIKADVF 66
           FI + ++ GKLLRNY+QNIDTLEQVAGI+ +I+CHGSFATASC  C ++V  EA++ D+F
Sbjct: 92  FIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIF 151
Query: 67  QQRIXXXXXXXXXXXXXXXDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMT 126
            Q +                   PA E  +        +MKP+IVFFGE LP+ FH AM 
Sbjct: 152 NQVVPRCP-------------RCPADEPLA--------IMKPEIVFFGENLPEQFHRAMK 190
Query: 127 LDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDVELLGDGDVIID 186
            DK+  DLLIVIGSSLKVRPVALIP+S+P  VPQILINRE L HL+FDVELLGD DVII+
Sbjct: 191 YDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIIN 250
Query: 187 TLCRALGESWT 197
            LC  LG  + 
Sbjct: 251 ELCHRLGGEYA 261
>pdb|4IAO|A Chain A, Crystal Structure Of Sir2 C543s Mutant In Complex With Sid Domain Of Sir4 Length = 492 Back     alignment and structure
>pdb|2HJH|A Chain A, Crystal Structure Of The Sir2 Deacetylase Length = 354 Back     alignment and structure
>pdb|4FVT|A Chain A, Human Sirt3 Bound To Ac-Acs Peptide And Carba-Nad Length = 274 Back     alignment and structure
>pdb|3GLR|A Chain A, Crystal Structure Of Human Sirt3 With Acetyl-Lysine Acecs2 Peptide Length = 285 Back     alignment and structure
>pdb|4HD8|A Chain A, Crystal Structure Of Human Sirt3 In Complex With Fluor-de-lys Peptide And Piceatannol Length = 284 Back     alignment and structure
>pdb|1J8F|A Chain A, Human Sirt2 Histone Deacetylase Length = 323 Back     alignment and structure
>pdb|1J8F|C Chain C, Human Sirt2 Histone Deacetylase Length = 323 Back     alignment and structure
>pdb|1SZC|A Chain A, Structural Basis For Nicotinamide Cleavage And Adp-Ribose Transfer By Nad+-Dependent Sir2 HistonePROTEIN DEACETYLASES Length = 297 Back     alignment and structure
>pdb|1Q1A|A Chain A, Structure Of The Yeast Hst2 Protein Deacetylase In Ternary Complex With 2'-O-Acetyl Adp Ribose And Histone Peptide Length = 289 Back     alignment and structure
>pdb|1Q17|A Chain A, Structure Of The Yeast Hst2 Protein Deacetylase In Ternary Complex With 2'-O-Acetyl Adp Ribose And Histone Peptide Length = 300 Back     alignment and structure
>pdb|2OD7|A Chain A, Crystal Structure Of Yhst2 Bound To The Intermediate Analogue Adp-Hpd, And And Aceylated H4 Peptide Length = 308 Back     alignment and structure
>pdb|1Q14|A Chain A, Structure And Autoregulation Of The Yeast Hst2 Homolog Of Sir2 Length = 361 Back     alignment and structure
>pdb|2OD2|A Chain A, Crystal Structure Of Yhst2 I117f Mutant Bound To Carba-Nad+ And An Acetylated H4 Peptide Length = 308 Back     alignment and structure
>pdb|1YC5|A Chain A, Sir2-P53 Peptide-Nicotinamide Length = 246 Back     alignment and structure
>pdb|4G1C|A Chain A, Human Sirt5 Bound To Succ-Idh2 And Carba-Nad Length = 267 Back     alignment and structure
>pdb|4HDA|A Chain A, Crystal Structure Of Human Sirt5 In Complex With Fluor-de-lys Peptide And Resveratrol Length = 275 Back     alignment and structure
>pdb|2NYR|A Chain A, Crystal Structure Of Human Sirtuin Homolog 5 In Complex With Suramin Length = 271 Back     alignment and structure
>pdb|3RIG|A Chain A, Sirt5 Is An Nad-Dependent Protein Lysine Demalonylase And Desuccinylase Length = 273 Back     alignment and structure
>pdb|2H4H|A Chain A, Sir2 H116y Mutant-P53 Peptide-Nad Length = 246 Back     alignment and structure
>pdb|2B4Y|A Chain A, Crystal Structure Of Human Sirtuin Homolog 5 Length = 271 Back     alignment and structure
>pdb|2H59|A Chain A, Sir2 H116a-Deacetylated P53 Peptide-3'-O-Acetyl Adp Ribose Length = 246 Back     alignment and structure
>pdb|1M2H|A Chain A, Sir2 Homologue S24a Mutant-adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2G|A Chain A, Sir2 Homologue-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1ICI|A Chain A, Crystal Structure Of A Sir2 Homolog-Nad Complex Length = 256 Back     alignment and structure
>pdb|1M2J|A Chain A, Sir2 Homologue H80n Mutant-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2N|A Chain A, Sir2 Homologues (D102gF159AR170A) MUTANT-2'-O-Acetyl Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1MA3|A Chain A, Structure Of A Sir2 Enzyme Bound To An Acetylated P53 Peptide Length = 253 Back     alignment and structure
>pdb|1M2K|A Chain A, Sir2 Homologue F159a Mutant-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|3JWP|A Chain A, Crystal Structure Of Plasmodium Falciparum Sir2a (Pf13_0152) In Complex With Amp Length = 265 Back     alignment and structure
>pdb|3U31|A Chain A, Plasmodium Falciparum Sir2a Preferentially Hydrolyzes Medium And Long Chain Fatty Acyl Lysine Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 2e-73
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 5e-68
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 1e-67
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 3e-64
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 1e-62
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 3e-60
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 6e-55
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 2e-53
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 6e-44
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 3e-38
1m2k_A249 Silent information regulator 2; protein-ligand com 5e-29
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 8e-28
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 7e-26
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Length = 354 Back     alignment and structure
 Score =  227 bits (580), Expect = 2e-73
 Identities = 90/209 (43%), Positives = 117/209 (55%), Gaps = 13/209 (6%)

Query: 7   FIKMLERHGKLLRNYSQNIDTLEQVAGI--ENVIECHGSFATASCTRCGHRVSAEAIKAD 64
           FIKML+  GKLLRNY+QNID LE  AGI  + +++CHGSFATA+C  C   +  E I   
Sbjct: 120 FIKMLQMKGKLLRNYTQNIDNLESYAGISTDKLVQCHGSFATATCVTCHWNLPGERIFNK 179

Query: 65  VFQQRIPLCPSPACLSSPTSSD-------ISVPAGESSSLPPTPSR--GVMKPDIVFFGE 115
           +    +PLCP           +       ++   G  S  PP      GV+KPDI FFGE
Sbjct: 180 IRNLELPLCPYCYKKRREYFPEGYNNKVGVAASQGSMSERPPYILNSYGVLKPDITFFGE 239

Query: 116 GLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPSVPQILINRERLSHLNFDV 175
            LP+ FH ++  D   CDLLI IG+SLKV PV+ I N +P  VPQ+LINR+ + H  FD+
Sbjct: 240 ALPNKFHKSIREDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQVLINRDPVKHAEFDL 299

Query: 176 ELLGDGDVIIDTLCRALGESWTGTLLELY 204
            LLG  D I   + +  G  WT    +  
Sbjct: 300 SLLGYCDDIAAMVAQKCG--WTIPHKKWN 326
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A Length = 285 Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Length = 323 Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Length = 289 Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Length = 361 Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Length = 246 Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Length = 318 Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Length = 355 Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Length = 253 Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Length = 290 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Length = 249 Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Length = 235 Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} PDB: 3rig_A* 2b4y_A* 2nyr_A* Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 100.0
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 100.0
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 100.0
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 100.0
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 100.0
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 100.0
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 100.0
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 100.0
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 100.0
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 100.0
1m2k_A249 Silent information regulator 2; protein-ligand com 100.0
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 100.0
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 100.0
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 100.0
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 98.12
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 97.76
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 97.37
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 96.72
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 95.45
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 95.01
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 94.31
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 92.78
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 92.24
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 92.05
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 92.02
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 91.76
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 91.69
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 90.68
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 90.28
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 89.52
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 89.38
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 89.3
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 89.0
1o97_D320 Electron transferring flavoprotein alpha-subunit; 88.74
1efv_A315 Electron transfer flavoprotein; electron transport 87.53
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 87.34
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 87.07
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 85.61
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 84.99
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 84.37
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 83.54
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 83.13
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 82.53
2k5c_A95 Uncharacterized protein PF0385; structural genomic 82.47
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 82.3
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 81.34
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 80.38
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
Probab=100.00  E-value=5e-54  Score=395.91  Aligned_cols=240  Identities=23%  Similarity=0.338  Sum_probs=158.6

Q ss_pred             CHHHHHHHHHHHcCCcceeEecCccchHhhcCC--CCeEeeccccceeeeCCCCceechHHHHHHHhh-CCCCCCCCCCC
Q psy12429          2 YAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGI--ENVIECHGSFATASCTRCGHRVSAEAIKADVFQ-QRIPLCPSPAC   78 (268)
Q Consensus         2 ~~~H~~La~L~~~g~l~~viTQNIDgLh~~AG~--~~vielHG~l~~~~C~~C~~~~~~~~~~~~~~~-~~~p~C~~~~C   78 (268)
                      +++|++|++|+++|++.+||||||||||++||+  ++|+|||||++..+|++|++.|.++.+...+.. ...+.|.  .|
T Consensus        92 n~~H~aLa~Le~~g~l~~viTQNIDgLh~rAG~~~~~VieLHGsl~~~~C~~C~~~~~~~~~~~~~~~~~~~~~C~--~~  169 (355)
T 3pki_A           92 TQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCT--VA  169 (355)
T ss_dssp             CHHHHHHHHHHHTTCCSEEEECCCSCHHHHEEEEGGGEEETTCCTTEEEETTTCCEEEBSSCCSCCSSCEEEEECC--CC
T ss_pred             CHHHHHHHHHHHcCCCcEEEEecccchHhhcCCCcccEEEeCCCCCceeeCCCCCccchHHhhhhcccCCCCCccc--cc
Confidence            689999999999999999999999999999998  589999999999999999999876543211100 0113454  33


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC-CCCcccCcEEEcCCCCCHHHHHHHHHhhhcCCeEEEEccCCcccccccccccC-CC
Q psy12429         79 LSSPTSSDISVPAGESSSLPPTP-SRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSL-PP  156 (268)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~-~~g~lrP~Iv~FgE~~p~~~~~~~~~~~~~aDlllviGTSl~V~p~~~l~~~~-~~  156 (268)
                      .                 .++|+ |+|.|||+||||||++|...++.+.+++++||++|||||||+|+|+++|+..+ .+
T Consensus       170 ~-----------------~~~~~~CgG~LRPdVV~FGE~lP~~~~~~A~~~~~~aDllLViGTSL~V~Paa~Lp~~a~~~  232 (355)
T 3pki_A          170 K-----------------ARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRR  232 (355)
T ss_dssp             C-----------------BTTBCCCCCEEEECCCCTTSCCCHHHHHHHHHHHHHCSEEEEESCCCCSTTGGGTTHHHHHT
T ss_pred             c-----------------ccccccCCCccCCCEEECCCcCCHHHHHHHHHHHhcCCEEEEEeeCCCchhhhhhHHHHHhc
Confidence            2                 11222 67999999999999999998999999999999999999999999999998774 67


Q ss_pred             CCCEEEEeeccCCCC-cccchhcCCchHHHHHHHHHhCC---Ccchh--HHH-hhhcCCCCCCceecccccccCCCcccc
Q psy12429        157 SVPQILINRERLSHL-NFDVELLGDGDVIIDTLCRALGE---SWTGT--LLE-LYNSLPPSVPQILINRERLSHLNFDVE  229 (268)
Q Consensus       157 g~~~i~IN~~~t~~~-~~dl~i~g~aD~vl~~L~~~LG~---~w~~~--~~~-~~~~~~~~~pqil~n~e~~~~~~~~~~  229 (268)
                      |+++|+||+++|..+ .+|+.|+|+|+++|+.|++.||+   .|..+  +++ .+.....++|++...+|.....|.++ 
T Consensus       233 G~~vviIN~~pT~~d~~adl~i~g~a~evl~~L~~~Lg~~iP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  311 (355)
T 3pki_A          233 GGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSI-  311 (355)
T ss_dssp             TCEEEEECSSCCTTGGGCSEEECSCHHHHHHHHHHHTTCCCCCCCSCEEECSCCSCCCBCCBCCC---------------
T ss_pred             CCEEEEECCCCCCCCCccCEEEeCCHHHHHHHHHHHhCCCCCCCCCCceecccCCCcCCCCCccCCccccCccccCCCC-
Confidence            899999999999875 68999999999999999999995   35553  222 24445566888888888887888777 


Q ss_pred             cCCCchhHHHHHHHHhCCcccccccccccCCCcccc
Q psy12429        230 LLGDGDVIIDTLCRALGESWTVRLKIEKVSSPREHL  265 (268)
Q Consensus       230 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  265 (268)
                       +...+   +|+|.++++++++++||||++||.+|+
T Consensus       312 -~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~  343 (355)
T 3pki_A          312 -PAGPK---QEPCAQHNGSEPASPKRERPTSPAPHR  343 (355)
T ss_dssp             ------------------------------------
T ss_pred             -CCCCC---CCCccccCCCCCCCccccCCCCCCCCC
Confidence             66666   999999999999999999999999997
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 268
d2b4ya1267 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirt 3e-31
d1j8fa_323 c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Ho 2e-28
d1q1aa_289 c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces c 9e-26
d1s5pa_235 c.31.1.5 (A:) NAD-dependent deacetylase CobB {Esch 5e-23
d1yc5a1245 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA 9e-23
d1m2ka_249 c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Ar 4e-20
d1ma3a_252 c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Arc 1e-19
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Sir2 family of transcriptional regulators
domain: NAD-dependent deacetylase sirtuin-5
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  114 bits (286), Expect = 3e-31
 Identities = 50/192 (26%), Positives = 77/192 (40%), Gaps = 13/192 (6%)

Query: 1   MYAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGIENVIECHGSFATASCTRCGHRVSAEA 60
             A       L + G+ +   +QNID L + AG +N++E HGS     CT CG       
Sbjct: 83  HRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENY- 141

Query: 61  IKADVFQQRIPLCP--SPACLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLP 118
                   + P+CP  S      P + D S+P  +          G+++P +V+FGE L 
Sbjct: 142 --------KSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD 193

Query: 119 DSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPS-VPQILINRERLSHLN-FDVE 176
            +    +  +   CDL +V+G+S  V P A+    +    VP    N E     N F   
Sbjct: 194 PAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFH 253

Query: 177 LLGDGDVIIDTL 188
             G     +   
Sbjct: 254 FQGPCGTTLPEA 265
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 289 Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Length = 235 Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Length = 245 Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 249 Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 100.0
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 100.0
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 100.0
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 100.0
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 100.0
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 100.0
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 97.98
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 97.07
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 97.07
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 96.94
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 96.71
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 96.68
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.67
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 96.64
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 96.53
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 96.47
d1efva2124 C-terminal domain of the electron transfer flavopr 94.55
d3clsd2123 C-terminal domain of the electron transfer flavopr 93.02
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 92.7
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 92.64
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 90.89
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 84.63
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 81.51
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 80.25
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Sir2 family of transcriptional regulators
domain: Sirt2 histone deacetylase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2e-47  Score=348.75  Aligned_cols=176  Identities=41%  Similarity=0.721  Sum_probs=159.1

Q ss_pred             CHHHHHHHHHHHcCCcceeEecCccchHhhcCC--CCeEeeccccceeeeCCCC--ceechHHHHHHHhhCCCCCCCCCC
Q psy12429          2 YAFDAFIKMLERHGKLLRNYSQNIDTLEQVAGI--ENVIECHGSFATASCTRCG--HRVSAEAIKADVFQQRIPLCPSPA   77 (268)
Q Consensus         2 ~~~H~~La~L~~~g~l~~viTQNIDgLh~~AG~--~~vielHG~l~~~~C~~C~--~~~~~~~~~~~~~~~~~p~C~~~~   77 (268)
                      +++|+||+.|+++|++.++|||||||||++||.  ++|+|+|||+++++|..|+  ..|+.+.+...+.....|.|+  .
T Consensus       113 n~~H~~l~~L~~~g~l~~viTQNIDgLh~~AG~~~~~viElHGsl~~~~C~~c~~~~~~~~~~~~~~~~~~~~p~C~--~  190 (323)
T d1j8fa_         113 TICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCE--D  190 (323)
T ss_dssp             CHHHHHHHHHHHTTCEEEEEECCCSCHHHHTTCCGGGEEETTEEEEEEEESCTTTCCEECHHHHHHHHHTTCCCBCT--T
T ss_pred             CHHHHHHHHHHHcCCceEEEeccccchhhccCCchhhheeeccccccceecccccchhhhhhhhhhhhccccccccc--c
Confidence            579999999999999999999999999999995  7899999999999999766  456666776666677789999  9


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCcccCcEEEcCCCCCHHHHHHHHHhhhcCCeEEEEccCCcccccccccccCCCC
Q psy12429         78 CLSSPTSSDISVPAGESSSLPPTPSRGVMKPDIVFFGEGLPDSFHSAMTLDKNRCDLLIVIGSSLKVRPVALIPNSLPPS  157 (268)
Q Consensus        78 C~~~~~~~~~~~~~~~~~~~~~~~~~g~lrP~Iv~FgE~~p~~~~~~~~~~~~~aDlllviGTSl~V~p~~~l~~~~~~g  157 (268)
                      |+                        |.|||+||||||++|+.+++.+.+++.+||++|||||||+|+|+++|+..++++
T Consensus       191 Cg------------------------G~lRP~VV~FGE~lP~~~~~~a~~~~~~aDllIViGTSL~V~Paa~l~~~a~~~  246 (323)
T d1j8fa_         191 CQ------------------------SLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLS  246 (323)
T ss_dssp             TC------------------------CBEEEEECCBTSCCCHHHHHHHHHGGGSCSEEEEESSCSCSHHHHHHHTTSCTT
T ss_pred             CC------------------------CccCCCEEEcCCCCcHHHHHHHHHHHhCCCEEEEECCCCeecCHHHHHHHHHcC
Confidence            97                        999999999999999998999999999999999999999999999999988888


Q ss_pred             CCEEEEeeccCCCC---------------------cccchhcCCchHHHHHHHHHhCCCcchhHHHhhh
Q psy12429        158 VPQILINRERLSHL---------------------NFDVELLGDGDVIIDTLCRALGESWTGTLLELYN  205 (268)
Q Consensus       158 ~~~i~IN~~~t~~~---------------------~~dl~i~g~aD~vl~~L~~~LG~~w~~~~~~~~~  205 (268)
                      ++.|+||++++...                     ..|+.+.|+||+++..|++.||  |+.++.++.+
T Consensus       247 ~~~v~IN~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~gdcd~~~~~l~~~lg--w~~e~~~l~~  313 (323)
T d1j8fa_         247 TPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLG--WKKELEDLVR  313 (323)
T ss_dssp             CCEEEEESSCCCCCCHHHHHHHHHHTCCCSSSTTCCSEEEEESCHHHHHHHHHHHTT--CHHHHHHHHH
T ss_pred             CCEEEEECCCCCCCCccchhhccccccccccccCCcceEEEccCHHHHHHHHHHHcC--CHHHHHHHHH
Confidence            89999999987631                     2589999999999999999999  9998887754
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure