Diaphorina citri psyllid: psy1242

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
RTYNDLNQYPVFPEFFYFIVICLITGRTYNDLNQYPVFPWVLTNYDSKELDLSLSTNYRDLSKPIGALNPSRMAYFEERYNSWEHENIKPFHYGTHYSTGVYVLNWLVRVPIGALNPSPSIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRPITTPLYPRDIWVTISVRSYAYDITVLSLRWIVDSCWRAVSGITASECSLRIMSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFRVFSTDNARIVQIIFGHYGVVTSRIVQIIFGHYGVVTCLSRSECNITADCFIASGSADCTVLLWHWNARTQSIVGETDTPTPRATLTGHEQPVTSVAISAELGLVVSGSQLGPVLVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQKTA
ccHHHcccccccccHHHHHHHHHHcccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHcccEEEEEEEEcccccccEEEccccccccccccccccccccccccccccEEcccccccccEEEEccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECccEEEEEccccEEEEEECccccEEEEEcccccEEEEEEccccccEEEEEEEEEEEccEEEEEEECccccccccEEEEECccccEEEEEEcccccccccccccccccEEEccccccEEEEEEcccccEEEECcccccEEEEEccccEEEECccccccccccEEEEcccccEEEEEcccEEEEEEEcccCEEEECccccccccc
*TYNDLNQYPVFPEFFYFIVICLITGRTYNDLNQYPVFPWVLTNYDSKELDLSLSTNYRDLSKPIGALNPSRMAYFEERYNSWEHENIKPFHYGTHYSTGVYVLNWLVRVPIGALNPSPSIQSPSYAETPGSPPGNLPLTLDPILT********PVPKRHLGDNFSQKLRVRPITTPLYPRDIWVTISVRSYAYDITVLSLRWIVDSCWRAVSGITASECSLRIMSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAA*****************LPLTLDPILTHPT***********LGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFRVFSTDNARIVQIIFGHYGVVTSRIVQIIFGHYGVVTCLSRSECNITADCFIASGSADCTVLLWHWNARTQSIVGE*****PRATLTGHEQPVTSVAISAELGLVVSGSQLGPVLVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHN**L****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RTYNDLNQYPVFPEFFYFIVICLITGRTYNDLNQYPVFPWVLTNYDSKELDLSLSTNYRDLSKPIGALNPSRMAYFEERYNSWEHENIKPFHYGTHYSTGVYVLNWLVRVPIGALNPSPSIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRPITTPLYPRDIWVTISVRSYAYDITVLSLRWIVDSCWRAVSGITASECSLRIMSPMMFSTVLDDVCMSLKFPSNSPICHVTANTYVTLHMPSVVTVTANHQFAINRWNPDYAASIQSPSYAETPGSPPGNLPLTLDPILTHPTSNNNAPVPKRHLGDNFSQKLRVRHNCFVTTVDSRFLLACGFWDNSFRVFSTDNARIVQIIFGHYGVVTSRIVQIIFGHYGVVTCLSRSECNITADCFIASGSADCTVLLWHWNARTQSIVGETDTPTPRATLTGHEQPVTSVAISAELGLVVSGSQLGPVLVHTTFGDLLRSLDPPSGFASPESVVMSREGVIVVNYERGHIAAFTMNGNRLRHESHNDNLQKTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. Required for correct retinal pattern formation and may function in cell fate determination through its interactions with the EGFR and Notch signaling pathways.confidentQ9W4E2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T77, chain A
Confidence level:very confident
Coverage over the Query: 2-226
View the alignment between query and template
View the model in PyMOL
Template: 2YMU, chain A
Confidence level:confident
Coverage over the Query: 253-429,442-540
View the alignment between query and template
View the model in PyMOL
Template: 2PBI, chain B
Confidence level:confident
Coverage over the Query: 234-249,267-375,391-429,441-540
View the alignment between query and template
View the model in PyMOL