Diaphorina citri psyllid: psy12432


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
ACSSRSTPKPRPPSPTPRPNITFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLPSRKQVMLETASIASGASIAVFLVVILCFSLYVHCQRRKKQAQAASVCCTDGPGSSLQRPRMPFERRPSPADFVLTRITTEAPRAADTRTSITITGKGDSVSASQLYHQSSPPLPHMSHPPSCTPLPPAPSQPPDDIKADMRSSQVSATLIV
cccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHHHHHHHHcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccc
********************ITFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLPSRKQVMLETASIASGASIAVFLVVILCFSLYVHCQ*************************************************************************************************************VSATLI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ACSSRSTPKPRPPSPTPRPNITFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLPSRKQVMLETASIASGASIAVFLVVILCFSLYVHCQRRKKQAQAASVCCTDGPGSSLQRPRMPFERRPSPADFVLTRITTEAPRAADTRTSITITGKGDSVSASQLYHQSSPPLPHMSHPPSCTPLPPAPSQPPDDIKADMRSSQVSATLIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000165 [BP]MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4D90, chain A
Confidence level:very confident
Coverage over the Query: 23-69
View the alignment between query and template
View the model in PyMOL
Template: 2KNC, chain A
Confidence level:probable
Coverage over the Query: 86-116
View the alignment between query and template
View the model in PyMOL