Psyllid ID: psy12432
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| 297499581 | 173 | TGF-alpha [Gryllus bimaculatus] | 0.611 | 0.809 | 0.751 | 1e-58 | |
| 157125095 | 224 | hypothetical protein AaeL_AAEL010067 [Ae | 0.624 | 0.638 | 0.659 | 4e-48 | |
| 170032640 | 210 | conserved hypothetical protein [Culex qu | 0.524 | 0.571 | 0.758 | 4e-48 | |
| 307201545 | 231 | Protein spitz [Harpegnathos saltator] | 0.711 | 0.705 | 0.627 | 2e-47 | |
| 328707918 | 288 | PREDICTED: hypothetical protein LOC10057 | 0.703 | 0.559 | 0.568 | 5e-47 | |
| 340727767 | 216 | PREDICTED: protein spitz-like [Bombus te | 0.659 | 0.699 | 0.673 | 1e-46 | |
| 350418171 | 216 | PREDICTED: protein spitz-like [Bombus im | 0.659 | 0.699 | 0.673 | 1e-46 | |
| 383849621 | 216 | PREDICTED: protein spitz-like [Megachile | 0.659 | 0.699 | 0.673 | 2e-46 | |
| 242024565 | 273 | conserved hypothetical protein [Pediculu | 0.620 | 0.520 | 0.713 | 4e-46 | |
| 307178475 | 216 | Protein spitz [Camponotus floridanus] | 0.615 | 0.652 | 0.698 | 1e-45 |
| >gi|297499581|gb|ADI43984.1| TGF-alpha [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
Score = 231 bits (590), Expect = 1e-58, Method: Compositional matrix adjust.
Identities = 109/145 (75%), Positives = 124/145 (85%), Gaps = 5/145 (3%)
Query: 1 ACSSRSTPKPRPPSPTPRPNITFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECAD 60
ACSSRSTPKPRPPSPT RPNITFHTYACPP +ATWYCLNGATCFTV IGESLLYNCECAD
Sbjct: 2 ACSSRSTPKPRPPSPTARPNITFHTYACPPAHATWYCLNGATCFTVNIGESLLYNCECAD 61
Query: 61 GYMGQRCEFKDLDGSYLPSRKQVMLETASIASGASIAVFLVVILCFSLYVHCQRRKKQAQ 120
GYMGQRCEFKDLDGSYLPSR++VMLETASIA GA+IAVFLVV++C ++Y+H QR+ K+++
Sbjct: 62 GYMGQRCEFKDLDGSYLPSRQRVMLETASIAGGATIAVFLVVLVCIAVYIHFQRKLKESR 121
Query: 121 AASVCCTDGPGSSLQRPRMPFERRP 145
A C DG L+ + PF R P
Sbjct: 122 AT---CVDGSSHDLE--KRPFSRDP 141
|
Source: Gryllus bimaculatus Species: Gryllus bimaculatus Genus: Gryllus Family: Gryllidae Order: Orthoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157125095|ref|XP_001660618.1| hypothetical protein AaeL_AAEL010067 [Aedes aegypti] gi|108873777|gb|EAT38002.1| AAEL010067-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170032640|ref|XP_001844188.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167873018|gb|EDS36401.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|307201545|gb|EFN81308.1| Protein spitz [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328707918|ref|XP_003243540.1| PREDICTED: hypothetical protein LOC100575788 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340727767|ref|XP_003402207.1| PREDICTED: protein spitz-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350418171|ref|XP_003491770.1| PREDICTED: protein spitz-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383849621|ref|XP_003700443.1| PREDICTED: protein spitz-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242024565|ref|XP_002432698.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518168|gb|EEB19960.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307178475|gb|EFN67164.1| Protein spitz [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| FB|FBgn0052179 | 217 | Krn "Keren" [Drosophila melano | 0.480 | 0.506 | 0.544 | 7.7e-32 | |
| FB|FBgn0005672 | 234 | spi "spitz" [Drosophila melano | 0.436 | 0.427 | 0.544 | 1.4e-29 | |
| ZFIN|ZDB-GENE-050311-1 | 178 | btc "betacellulin, epidermal g | 0.393 | 0.505 | 0.29 | 2.9e-09 | |
| MGI|MGI:98724 | 159 | Tgfa "transforming growth fact | 0.467 | 0.672 | 0.290 | 5.3e-08 | |
| RGD|3849 | 159 | Tgfa "transforming growth fact | 0.467 | 0.672 | 0.290 | 6.8e-08 | |
| UNIPROTKB|F1NEP5 | 1245 | EGF "Uncharacterized protein" | 0.349 | 0.064 | 0.379 | 9.1e-08 | |
| UNIPROTKB|P01135 | 160 | TGFA "Protransforming growth f | 0.467 | 0.668 | 0.273 | 1.8e-07 | |
| UNIPROTKB|F1SLD3 | 125 | TGFA "Protransforming growth f | 0.445 | 0.816 | 0.276 | 3.8e-07 | |
| UNIPROTKB|Q06922 | 160 | TGFA "Protransforming growth f | 0.467 | 0.668 | 0.264 | 6.1e-07 | |
| UNIPROTKB|P55244 | 121 | TGFA "Protransforming growth f | 0.445 | 0.842 | 0.276 | 6.1e-07 |
| FB|FBgn0052179 Krn "Keren" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 349 (127.9 bits), Expect = 7.7e-32, P = 7.7e-32
Identities = 61/112 (54%), Positives = 81/112 (72%)
Query: 20 NITFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLPS 79
N+TF +ACPPTY WYCLN TCFTVKI +LYNCECA G+MG RCE+K++DGSYLP+
Sbjct: 54 NVTFPIFACPPTYVAWYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPT 113
Query: 80 RKQVMLETASIASGASIAVFLVVILCFSLYVHCQRRKKQA--QAASVCCTDG 129
R +VMLE ASI SGA++A+ + + C LY+ ++ +KQ + + TDG
Sbjct: 114 RNRVMLEKASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHDSTTTTTTDG 165
|
|
| FB|FBgn0005672 spi "spitz" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050311-1 btc "betacellulin, epidermal growth factor family member" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98724 Tgfa "transforming growth factor alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3849 Tgfa "transforming growth factor alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEP5 EGF "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P01135 TGFA "Protransforming growth factor alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SLD3 TGFA "Protransforming growth factor alpha" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q06922 TGFA "Protransforming growth factor alpha" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P55244 TGFA "Protransforming growth factor alpha" [Macaca mulatta (taxid:9544)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| KOG1219|consensus | 4289 | 99.43 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 99.34 | |
| PF02158 | 404 | Neuregulin: Neuregulin family; InterPro: IPR002154 | 98.76 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 98.43 | |
| KOG1219|consensus | 4289 | 98.21 | ||
| KOG4289|consensus | 2531 | 97.87 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.73 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.76 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 96.46 | |
| KOG4289|consensus | 2531 | 96.22 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.14 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 96.01 | |
| PF02439 | 38 | Adeno_E3_CR2: Adenovirus E3 region protein CR2; In | 95.78 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.19 | |
| PF14575 | 75 | EphA2_TM: Ephrin type-A receptor 2 transmembrane d | 95.17 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 94.78 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 94.69 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 94.49 | |
| PF14991 | 118 | MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P | 94.01 | |
| PF12273 | 130 | RCR: Chitin synthesis regulation, resistance to Co | 93.98 | |
| PF05454 | 290 | DAG1: Dystroglycan (Dystrophin-associated glycopro | 93.43 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 93.14 | |
| KOG1214|consensus | 1289 | 92.96 | ||
| PF13908 | 179 | Shisa: Wnt and FGF inhibitory regulator | 92.61 | |
| PF01034 | 64 | Syndecan: Syndecan domain; InterPro: IPR001050 The | 91.33 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 89.96 | |
| PF05393 | 94 | Hum_adeno_E3A: Human adenovirus early E3A glycopro | 89.21 | |
| PF15069 | 143 | FAM163: FAM163 family | 89.03 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 88.76 | |
| PF07204 | 98 | Orthoreo_P10: Orthoreovirus membrane fusion protei | 88.7 | |
| KOG2052|consensus | 513 | 88.46 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 88.4 | |
| PF08374 | 221 | Protocadherin: Protocadherin; InterPro: IPR013585 | 87.4 | |
| KOG3516|consensus | 1306 | 87.02 | ||
| PF12877 | 684 | DUF3827: Domain of unknown function (DUF3827); Int | 86.22 | |
| KOG3514|consensus | 1591 | 86.2 | ||
| PF00558 | 81 | Vpu: Vpu protein; InterPro: IPR008187 The Human im | 85.42 | |
| KOG3607|consensus | 716 | 84.81 | ||
| PF15330 | 107 | SIT: SHP2-interacting transmembrane adaptor protei | 84.74 | |
| PF05545 | 49 | FixQ: Cbb3-type cytochrome oxidase component FixQ; | 84.17 | |
| KOG1225|consensus | 525 | 83.29 | ||
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 82.9 | |
| KOG1225|consensus | 525 | 81.9 | ||
| KOG1217|consensus | 487 | 80.73 | ||
| PF01299 | 306 | Lamp: Lysosome-associated membrane glycoprotein (L | 80.43 |
| >KOG1219|consensus | Back alignment and domain information |
|---|
Probab=99.43 E-value=5e-13 Score=141.87 Aligned_cols=170 Identities=21% Similarity=0.381 Sum_probs=99.0
Q ss_pred CCceeeCCCCCCC------------CCCCCCCEEEeeccCCCCceEeecCCCCCCCCCcccC----C-------------
Q psy12432 22 TFHTYACPPTYAT------------WYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKD----L------------- 72 (229)
Q Consensus 22 ~gy~C~C~~gy~g------------npClNGGtC~~~~~~~~~~~sC~C~~Gy~G~rCe~~~----~------------- 72 (229)
.||.|+|+.-|.| +||++||+|.... ++|.|.|+.||+|.|||... .
T Consensus 3884 ggy~CkCpsqysG~~CEi~~epC~snPC~~GgtCip~~----n~f~CnC~~gyTG~~Ce~~Gi~eCs~n~C~~gg~C~n~ 3959 (4289)
T KOG1219|consen 3884 GGYKCKCPSQYSGNHCEIDLEPCASNPCLTGGTCIPFY----NGFLCNCPNGYTGKRCEARGISECSKNVCGTGGQCINI 3959 (4289)
T ss_pred CceEEeCcccccCcccccccccccCCCCCCCCEEEecC----CCeeEeCCCCccCceeecccccccccccccCCceeecc
Confidence 3899999999997 5999999998763 37999999999999999872 1
Q ss_pred CCCcc----cc-c----------chhhhHHHHH--hhhHHHHHHHHHHHHHHHHHHHHHhhhhhhhccccccCCCCCCCC
Q psy12432 73 DGSYL----PS-R----------KQVMLETASI--ASGASIAVFLVVILCFSLYVHCQRRKKQAQAASVCCTDGPGSSLQ 135 (229)
Q Consensus 73 ~~~~~----p~-~----------~~~~~~~~~I--a~gI~V~lLLVlii~vvly~~~kRrk~~k~~~~~~~~d~~~~~~~ 135 (229)
.|+|+ +. . ......|.+. +++|+|+|++ ++++++++|+++|++.+|+-...+-+|--
T Consensus 3960 ~gsf~CncT~g~~gr~c~~~~pni~~~~~~~gkaEli~I~V~l~~-ifilvvlf~~crKk~~rkky~~~~~~~ll----- 4033 (4289)
T KOG1219|consen 3960 PGSFHCNCTPGILGRTCCAEKPNILSTVLWLGKAELIIIIVLLAL-IFILVVLFWKCRKKNSRKKYGAHCPVDLL----- 4033 (4289)
T ss_pred CCceEeccChhHhcccCccccCccccccchhcccceeehhHHHHH-HHHHHHHHHhhhhhccCCcccccCChhHH-----
Confidence 11121 10 0 0112233222 2334444433 33444466666666555544333322210
Q ss_pred CCCCCCccCCCCcceeeeeccccCCCCCCCCCccc--ccCCCCCCcCCCccccCCCCCC-CCCCCCCCCCCCCCCC
Q psy12432 136 RPRMPFERRPSPADFVLTRITTEAPRAADTRTSIT--ITGKGDSVSASQLYHQSSPPLP-HMSHPPSCTPLPPAPS 208 (229)
Q Consensus 136 ~~~~~~~~~~~p~~~~~~~~~~e~~~~~~~~~~ld--~~~~g~~~~~~~~f~~~~~~~~-~~~~~~~~~~~~~~~~ 208 (229)
++++=....|++-----|++...+|||| ..+.+..++||.+|++++..+. .-|-+|--.|++|--|
T Consensus 4034 -------~rn~nVy~~v~PqvplrP~sytsrnNld~n~~s~ssv~~e~~Tf~Pes~~r~vvcSvapnlp~pspc~S 4102 (4289)
T KOG1219|consen 4034 -------RRNTNVYVPVVPQVPLRPRSYTSRNNLDSNFISTSSVPTELVTFRPESQVRPVVCSVAPNLPPPSPCGS 4102 (4289)
T ss_pred -------hcCCCccccCCCCCCcCCcccccccccCcCCcccCCccccccccCCCccccceeeccCCCCCCCCCCCC
Confidence 0111111111110001133444789999 8899999999999999999877 5555555444443333
|
|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF02158 Neuregulin: Neuregulin family; InterPro: IPR002154 Neuregulins are a sub-family of EGF-like molecules that have been shown to play multiple essential roles in vertebrate embryogenesis including: cardiac development, Schwann cell and oligodendrocyte differentiation, some aspects of neuronal development, as well as the formation of neuromuscular synapses [, ] | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF14991 MLANA: Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P | Back alignment and domain information |
|---|
| >PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls | Back alignment and domain information |
|---|
| >PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF13908 Shisa: Wnt and FGF inhibitory regulator | Back alignment and domain information |
|---|
| >PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2 | Back alignment and domain information |
|---|
| >PF15069 FAM163: FAM163 family | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >PF07204 Orthoreo_P10: Orthoreovirus membrane fusion protein p10; InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >PF00558 Vpu: Vpu protein; InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [] | Back alignment and domain information |
|---|
| >KOG3607|consensus | Back alignment and domain information |
|---|
| >PF15330 SIT: SHP2-interacting transmembrane adaptor protein, SIT | Back alignment and domain information |
|---|
| >PF05545 FixQ: Cbb3-type cytochrome oxidase component FixQ; InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ) | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 229 | ||||
| 3ltf_D | 58 | Crystal Structure Of The Drosophila Epidermal Growt | 1e-16 | ||
| 3c9a_C | 52 | High Resolution Crystal Structure Of Argos Bound To | 2e-14 | ||
| 1egf_A | 53 | Solution Structure Of Murine Epidermal Growth Facto | 5e-04 | ||
| 1gk5_A | 49 | Solution Structure The MegfTGFALPHA44-50 Chimeric G | 8e-04 |
| >pdb|3LTF|D Chain D, Crystal Structure Of The Drosophila Epidermal Growth Factor Receptor Ectodomain In Complex With Spitz Length = 58 | Back alignment and structure |
|
| >pdb|3C9A|C Chain C, High Resolution Crystal Structure Of Argos Bound To The Egf Domain Of Spitz Length = 52 | Back alignment and structure |
| >pdb|1EGF|A Chain A, Solution Structure Of Murine Epidermal Growth Factor Determined By Nmr Spectroscopy And Refined By Energy Minimization With Restraints Length = 53 | Back alignment and structure |
| >pdb|1GK5|A Chain A, Solution Structure The MegfTGFALPHA44-50 Chimeric Growth Factor Length = 49 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 1e-27 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 1e-25 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 4e-13 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 4e-13 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 9e-08 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 2e-07 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 3e-07 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 4e-06 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 1e-05 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 6e-05 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 7e-05 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 9e-05 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 3e-04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 7e-05 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 9e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-04 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-04 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 4e-04 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 7e-04 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 5e-04 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 8e-04 |
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Length = 58 | Back alignment and structure |
|---|
Score = 99.2 bits (247), Expect = 1e-27
Identities = 35/57 (61%), Positives = 44/57 (77%)
Query: 22 TFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLP 78
TF TY CP T+ WYCLN A CF VKI + +Y+CECA G+MGQRCE+K++D +YLP
Sbjct: 1 TFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLP 57
|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Length = 52 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Length = 50 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Length = 50 | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Length = 45 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Length = 46 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 98.91 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.91 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 98.75 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 98.74 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.67 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 98.59 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.47 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.46 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.34 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.34 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 98.13 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.06 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.98 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.74 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.62 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.42 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.32 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.24 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 97.13 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.93 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.8 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.75 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.74 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 96.69 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.66 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.59 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 96.51 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.48 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.35 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.31 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.27 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 96.26 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.18 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 96.16 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 96.07 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 95.91 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 95.78 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 95.76 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.74 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.71 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 95.64 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.59 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 95.54 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 95.51 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 95.47 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 95.46 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.41 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 95.3 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 95.23 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 95.16 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 95.15 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 95.12 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 95.11 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 95.09 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 95.07 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 95.05 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 94.92 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 94.88 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 94.75 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 94.31 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 94.23 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 94.16 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 93.99 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 93.03 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 92.79 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 92.5 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 91.96 | |
| 2l8s_A | 54 | Integrin alpha-1; transmembrane region, detergent | 91.39 | |
| 2knc_A | 54 | Integrin alpha-IIB; transmembrane signaling, prote | 91.36 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 91.31 | |
| 2knc_B | 79 | Integrin beta-3; transmembrane signaling, protein | 91.26 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 90.97 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 90.84 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 90.8 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 90.4 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 90.27 | |
| 2k9j_B | 43 | Integrin beta-3; transmembrane complex, cell adhes | 90.16 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 90.09 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 89.5 | |
| 2k9y_A | 41 | Ephrin type-A receptor 2; receptor tyrosine kinase | 89.42 | |
| 1iij_A | 35 | ERBB-2 receptor protein-tyrosine kinase; alpha-hel | 89.39 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 88.97 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 88.65 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 88.15 | |
| 2k1a_A | 42 | Integrin alpha-IIB; single-PASS transmembrane segm | 87.96 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 87.82 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 87.35 | |
| 2klu_A | 70 | T-cell surface glycoprotein CD4; cell membrane, di | 86.84 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 86.28 | |
| 1pi7_A | 36 | VPU protein, U ORF protein; alpha helix, viral pro | 86.01 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 85.67 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 84.8 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 84.51 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 84.49 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 84.19 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 83.55 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 82.94 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 81.5 | |
| 2knc_B | 79 | Integrin beta-3; transmembrane signaling, protein | 81.11 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 80.98 |
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=98.91 E-value=1.7e-10 Score=80.06 Aligned_cols=56 Identities=61% Similarity=1.396 Sum_probs=44.5
Q ss_pred CceeeCCCCCCCCCCCCCCEEEeeccCCCCceEeecCCCCCCCCCcccCCCCCccc
Q psy12432 23 FHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDLDGSYLP 78 (229)
Q Consensus 23 gy~C~C~~gy~gnpClNGGtC~~~~~~~~~~~sC~C~~Gy~G~rCe~~~~~~~~~p 78 (229)
++.-.|++.|+++||+|||+|..........+.|.|+.||+|.+||.....+.|+|
T Consensus 2 ~~~~~C~~~~~~~pC~NGGtC~~~~~~~~~~~~C~C~~Gf~G~~Ce~~~~~~~y~~ 57 (58)
T 3ltf_D 2 FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLP 57 (58)
T ss_dssp CCCBCCCHHHHHHTSCSSCEEEEEEETTEEEEEEEECTTEESSSSCEECCCCCSCC
T ss_pred cccccCCccccCCcCCCCCEEeCCccCCCCCEEeECCCCCccCCCcccCCCCcCcc
Confidence 56778999887669999999985320012369999999999999999988777765
|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2k9j_B Integrin beta-3; transmembrane complex, cell adhesion, cleavage on basic residues, disease mutation, glycoprotein, pyrrolidone carboxylic acid; NMR {Homo sapiens} PDB: 2rmz_A 2rn0_A 2l91_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1pi7_A VPU protein, U ORF protein; alpha helix, viral protein; NMR {Human immunodeficiency virus 1} SCOP: j.35.1.1 PDB: 1pi8_A 1pje_A 2gof_A 2goh_A 2jpx_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 229 | ||||
| d1moxc_ | 49 | g.3.11.1 (C:) Transforming growth factor alpha {Hu | 3e-11 | |
| d1ioxa_ | 50 | g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) | 1e-10 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 8e-10 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 8e-09 | |
| d1k36a_ | 46 | g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo | 3e-06 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 7e-05 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 9e-05 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 1e-04 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 1e-04 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 1e-04 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 1e-04 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 2e-04 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 3e-04 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 6e-04 | |
| d1xdtr_ | 41 | g.3.11.1 (R:) Heparin-binding epidermal growth fac | 7e-04 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 0.002 | |
| d2i9aa1 | 40 | g.3.11.1 (A:10-49) Plasminogen activator (urokinas | 0.004 |
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Transforming growth factor alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.5 bits (131), Expect = 3e-11
Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)
Query: 24 HTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDL 72
H CP ++ T +C +G F + + C C GY+G RCE DL
Sbjct: 3 HFNDCPDSH-TQFCFHGTCRF---LVQEDKPACVCHSGYVGARCEHADL 47
|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 98.93 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.86 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 98.86 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.81 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 98.57 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 98.48 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.47 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.44 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.31 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.28 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.27 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.24 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.23 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.21 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.18 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.12 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.05 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.02 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.62 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.33 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 90.7 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 90.1 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 89.35 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 86.56 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 86.32 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 86.2 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 84.91 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 83.54 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 83.42 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 83.2 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 82.91 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 82.44 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.38 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 81.84 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 81.51 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 81.07 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 80.78 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 80.53 |
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Betacellulin-2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.93 E-value=2.6e-10 Score=75.59 Aligned_cols=47 Identities=40% Similarity=0.872 Sum_probs=40.8
Q ss_pred CCceeeCCCCCCCCCCCCCCEEEeeccCCCCceEeecCCCCCCCCCcccCC
Q psy12432 22 TFHTYACPPTYATWYCLNGATCFTVKIGESLLYNCECADGYMGQRCEFKDL 72 (229)
Q Consensus 22 ~gy~C~C~~gy~gnpClNGGtC~~~~~~~~~~~sC~C~~Gy~G~rCe~~~~ 72 (229)
+||+-+|++.|. +||+|||+|+... ...+.|+|+.||+|+|||+.++
T Consensus 2 ~gh~~pC~~~~~-~yC~nGgcc~~~~---~~~~~C~C~~gy~G~rCe~~~l 48 (50)
T d1ioxa_ 2 KGHFSRCPKQYK-HYCIKGRCRFVVA---EQTPSCVCDEGYIGARCERVDL 48 (50)
T ss_dssp CCCCEECCGGGT-TSCTTCCEEEETT---TTEEEECCCTTEETTTTCEECC
T ss_pred CCccCccCcccC-CCccCCeEEEeCC---CCCcEeECCCCCeeCCCcccee
Confidence 589999999995 8999999998754 2379999999999999999864
|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|