Diaphorina citri psyllid: psy12437


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-
MQPLVSNKQGPNSYGSASNVMQVPLIASNPSQPSGAAPPISGLQPQVPVSNSSLQTPLGSSNMMRPPLVTNRFQAPGATINSLSTPVPQQFQRPQQQNANHSQQTFRMPPNTYSQSSKTAPFNNGLTPLTNASLYQQQQQQQQQQQQQQQPIPNIPPLPNSQQNSSNFQPSNNLYNNIQVPPRAQPGNYPSVPAGYPSLNQAGYQQQQQQQQQQQQQQQTLNSQFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPGALQSRENPNQRSNDDPPHMNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKVLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIREQV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccEEEEEEcccccccccccccEEEEEEEccHHHHHHccHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEccccccccccccccccccccccccccccEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEcccccccccccccccccCEEEEECccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEEEEEEEcccccCCccccccccEEEEEEEEcccccccccEEEEEEEEEEcccccEEEEEEEccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHccccEEEEEEcccEEEEEEcccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccHHHHHHHHHHcc
***************************************************************************************************************************************************************************************************YPS*******************QQTLNSQFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPG******************MNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKVLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIREQV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPLVSNKQGPNSYGSASNVMQVPLIASNPSQPSGAAPPISGLQPQVPVSNSSLQTPLGSSNMMRPPLVTNRFQAPGATINSLSTPVPQQFQRPQQQNANHSQQTFRMPPNTYSQSSKTAPFNNGLTPLTNASLYQQQQQQQQQQQQQQQPIPNIPPLPNSQQNSSNFQPSNNLYNNIQVPPRAQPGNYPSVPAGYPSLNQAGxxxxxxxxxxxxxxxxxxxxxFSNLSVNQGMNKMWGYEPHDLLNTRDILPATKVEPPPIRLPQNLPEIHEQFLYDRNTEMFGDPYRRPEIQSATVEYLATADYTVRDPPQPAMYLFLLDVSQIAAQSGYLYTVCEVLLNQLKSMPGDRRTSIAIITYDSAVHFYSLAEGQTQPSQMILTDIDDIFLPSPENILVNLSECYDMIVDLLKQLPGKFKDSLDSGSALGPALQAAFKLLQPTGGRITIFQTCLPNRGPGALQSRENPNQRSNDDPPHMNPATDFYKKIALECTSFYIAVDLFILNSQYVDLATLSGVSKFSSGCIHHIPLYSGKNMSHVYQLDRMFSRYLTRKIGFESVMRIRCTKGMSIHTFHGNFFVRSTDLLALPNVNPDAGYGIQISIDENLTHIQYACFQVAVLYTSSKGDRRIRVHTLCLPVVSNINDVLVGADQACIAGLLAKMAVDRSLQHSLSDAREAFLNVVCDVLSTYKMTQAGHLTGSLLAPSSLKVLPLYVLALLKHPAFRIGQSTRLDDRLFAMTEMKCLPLNSLMLSIYPELYPIHTLDQDPTIEWNELQVPIPRILQLSAERLQATGTYLLNMPDLIIILVRHGTSPAICSGLFGFQSVAQMPETLFELPQLETQLSLKLNSFISYLNDDKAYVSPVKVIKDSSPDRMEFYDKLIEDKNAGGMAYYEFLLRIREQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein SEC24 Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.confidentQ6CLE0
Protein transport protein Sec24B Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.confidentO95487
Protein transport protein SEC24 Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules.confidentQ0PVD8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0090110 [BP]cargo loading into COPII-coated vesicleprobableGO:0022607, GO:0070271, GO:0043933, GO:0006900, GO:0035459, GO:0061024, GO:0034622, GO:0044699, GO:0006888, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0051641, GO:0006461, GO:0048193, GO:0006810, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0043623, GO:0051179, GO:0016482, GO:0006996, GO:0090114, GO:0016192, GO:0046907, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0070971 [CC]endoplasmic reticulum exit siteprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EH1, chain A
Confidence level:very confident
Coverage over the Query: 245-901
View the alignment between query and template
View the model in PyMOL