Diaphorina citri psyllid: psy1243

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MPAAIASSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTPPRQV
cccccccccccccccccEEEEEEccHHHHccccccccccccccEEcccccccccccccccccEEEECcccccccEEEEECccccccEEEEcccccHHHHHHHHHccccccccccccccccc
************ALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEA******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAAIASSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTPPRQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine protease hepsin Plays an essential role in cell growth and maintenance of cell morphology.confidentQ5R5E8
Serine protease hepsin Plays an essential role in cell growth and maintenance of cell morphology.confidentP05981
Serine protease hepsin Plays an essential role in cell growth and maintenance of cell morphology.confidentO35453

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0009893 [BP]positive regulation of metabolic processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z8G, chain A
Confidence level:very confident
Coverage over the Query: 9-104
View the alignment between query and template
View the model in PyMOL