Psyllid ID: psy1243


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MPAAIASSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTPPRQV
cccccccccccccccccEEEEEEccHHHHccccccccccccccEEcccccccccccccccccEEEEEcccccccEEEEEEccccccEEEEcccccHHHHHHHHHccccccccccccccccc
ccccccccccccccccEEEEEEEEcHHHHHHHHHccccccccEEEEccccccccccccccccEEEEccEcEEEEEEccccccccccEEEEEHHHHHHHHHHHHHccccccccccccccccc
mpaaiasssaSNALTLKAARVGtlsqescrkedaygtrikdsmfcagsfqggadscqgdsggpivcdiqgcdkgaslgtdRLSRACYVLSKMIRFYASVgieatsscspgdpltttpprqv
mpaaiasssasnaltlkaarvgtlsqescrKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIeatsscspgdpltttpprqv
MPaaiasssasnaltlkaaRVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTPPRQV
*********************************AYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIE*******************
**AAI*******ALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEA******************
**********SNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSC**************
*******SSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATS****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAAIASSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTPPRQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
O35453436 Serine protease hepsin OS yes N/A 0.462 0.128 0.553 5e-12
Q05511416 Serine protease hepsin OS yes N/A 0.867 0.252 0.394 1e-11
Q14C59416 Transmembrane protease se no N/A 0.487 0.141 0.457 6e-11
Q5R5E8417 Serine protease hepsin OS yes N/A 0.438 0.127 0.547 8e-11
P05981417 Serine protease hepsin OS yes N/A 0.438 0.127 0.547 9e-11
Q6IE14420 Transmembrane protease se no N/A 0.487 0.140 0.457 9e-11
P35041267 Trypsin-7 OS=Anopheles ga yes N/A 0.487 0.220 0.540 3e-10
Q3UQ41389 Transmembrane protease se no N/A 0.413 0.128 0.52 4e-10
P00748615 Coagulation factor XII OS no N/A 0.512 0.100 0.467 4e-10
P36376259 Glandular kallikrein-12, no N/A 0.669 0.312 0.360 9e-10
>sp|O35453|HEPS_MOUSE Serine protease hepsin OS=Mus musculus GN=Hpn PE=2 SV=3 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 12  NALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCD 67
            A+ L+ ARV  +S E C   D YG +IK  MFCAG  +GG D+CQGDSGGP VC+
Sbjct: 324 QAMVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE 379




Plays an essential role in cell growth and maintenance of cell morphology.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 0EC: 6
>sp|Q05511|HEPS_RAT Serine protease hepsin OS=Rattus norvegicus GN=Hpn PE=2 SV=1 Back     alignment and function description
>sp|Q14C59|TM11L_MOUSE Transmembrane protease serine 11B-like protein OS=Mus musculus GN=Tmprss11bnl PE=2 SV=2 Back     alignment and function description
>sp|Q5R5E8|HEPS_PONAB Serine protease hepsin OS=Pongo abelii GN=HPN PE=2 SV=1 Back     alignment and function description
>sp|P05981|HEPS_HUMAN Serine protease hepsin OS=Homo sapiens GN=HPN PE=1 SV=1 Back     alignment and function description
>sp|Q6IE14|TM11L_RAT Transmembrane protease serine 11B-like protein OS=Rattus norvegicus GN=Tmprss11bnl PE=2 SV=1 Back     alignment and function description
>sp|P35041|TRY7_ANOGA Trypsin-7 OS=Anopheles gambiae GN=TRYP7 PE=2 SV=2 Back     alignment and function description
>sp|Q3UQ41|TM11A_MOUSE Transmembrane protease serine 11A OS=Mus musculus GN=Tmprss11a PE=2 SV=1 Back     alignment and function description
>sp|P00748|FA12_HUMAN Coagulation factor XII OS=Homo sapiens GN=F12 PE=1 SV=3 Back     alignment and function description
>sp|P36376|KLK12_RAT Glandular kallikrein-12, submandibular/renal OS=Rattus norvegicus GN=Klk12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
149056233 325 hepsin, isoform CRA_a [Rattus norvegicus 0.867 0.323 0.403 4e-11
148692006 306 hepsin, isoform CRA_b [Mus musculus] 0.462 0.183 0.553 1e-10
2606037 416 hepsin [Mus musculus] 0.462 0.134 0.553 2e-10
159110508 416 serine protease hepsin isoform 2 precurs 0.462 0.134 0.553 2e-10
443287649 445 serine protease hepsin isoform 3 precurs 0.462 0.125 0.553 2e-10
74224366 445 unnamed protein product [Mus musculus] 0.462 0.125 0.553 2e-10
159110512 436 serine protease hepsin isoform 1 precurs 0.462 0.128 0.553 2e-10
26362705 435 unnamed protein product [Mus musculus] 0.462 0.128 0.553 2e-10
317419417 473 Hyaluronan-binding protein 2, partial [D 0.429 0.109 0.596 2e-10
260830910 239 hypothetical protein BRAFLDRAFT_209243 [ 0.545 0.276 0.485 3e-10
>gi|149056233|gb|EDM07664.1| hepsin, isoform CRA_a [Rattus norvegicus] gi|149056234|gb|EDM07665.1| hepsin, isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 61/114 (53%), Gaps = 9/114 (7%)

Query: 12  NALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCD--IQ 69
            A+ L+ ARV  +S E C   D YG +IK  MFCAG  +GG D+CQGDSGGP VC+  I 
Sbjct: 213 QAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDRIS 272

Query: 70  GCDKG-----ASLGTD-RLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTP 117
           G  +       S GT   L+R   V +K+I F   +  +A  + S    + T P
Sbjct: 273 GTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWI-FQAIKTHSEATGMVTQP 325




Source: Rattus norvegicus

Species: Rattus norvegicus

Genus: Rattus

Family: Muridae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|148692006|gb|EDL23953.1| hepsin, isoform CRA_b [Mus musculus] Back     alignment and taxonomy information
>gi|2606037|gb|AAB84221.1| hepsin [Mus musculus] Back     alignment and taxonomy information
>gi|159110508|ref|NP_032307.2| serine protease hepsin isoform 2 precursor [Mus musculus] gi|148692007|gb|EDL23954.1| hepsin, isoform CRA_c [Mus musculus] Back     alignment and taxonomy information
>gi|443287649|ref|NP_001263198.1| serine protease hepsin isoform 3 precursor [Mus musculus] Back     alignment and taxonomy information
>gi|74224366|dbj|BAE33755.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|159110512|ref|NP_001103722.1| serine protease hepsin isoform 1 precursor [Mus musculus] gi|341941076|sp|O35453.3|HEPS_MOUSE RecName: Full=Serine protease hepsin; Contains: RecName: Full=Serine protease hepsin non-catalytic chain; Contains: RecName: Full=Serine protease hepsin catalytic chain gi|148692005|gb|EDL23952.1| hepsin, isoform CRA_a [Mus musculus] gi|187953015|gb|AAI38810.1| Hepsin [Mus musculus] gi|219519395|gb|AAI45414.1| Hepsin [Mus musculus] Back     alignment and taxonomy information
>gi|26362705|dbj|BAB22289.2| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|317419417|emb|CBN81454.1| Hyaluronan-binding protein 2, partial [Dicentrarchus labrax] Back     alignment and taxonomy information
>gi|260830910|ref|XP_002610403.1| hypothetical protein BRAFLDRAFT_209243 [Branchiostoma floridae] gi|229295768|gb|EEN66413.1| hypothetical protein BRAFLDRAFT_209243 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
UNIPROTKB|F1LS97416 Hpn "Serine protease hepsin" [ 0.801 0.233 0.415 1.1e-11
UNIPROTKB|F1LY39435 Hpn "Serine protease hepsin" [ 0.801 0.222 0.415 1.2e-11
UNIPROTKB|F1LY41436 Hpn "Serine protease hepsin" [ 0.801 0.222 0.415 1.2e-11
MGI|MGI:1196620436 Hpn "hepsin" [Mus musculus (ta 0.801 0.222 0.405 4.2e-11
UNIPROTKB|I3L6R5186 HPN "Uncharacterized protein" 0.396 0.258 0.562 5.8e-11
RGD|61982416 Hpn "hepsin" [Rattus norvegicu 0.801 0.233 0.405 1e-10
UNIPROTKB|G1NYX6417 HPN "Uncharacterized protein" 0.396 0.115 0.562 1.7e-10
UNIPROTKB|G1U4B0430 HPN "Uncharacterized protein" 0.396 0.111 0.583 1.8e-10
RGD|735032188 Klk1c3 "kallikrein 1-related p 0.570 0.367 0.405 2.5e-10
UNIPROTKB|B7Z1L4393 HPN "cDNA FLJ57261, highly sim 0.396 0.122 0.562 3.2e-10
UNIPROTKB|F1LS97 Hpn "Serine protease hepsin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 1.1e-11, P = 1.1e-11
 Identities = 44/106 (41%), Positives = 57/106 (53%)

Query:    20 RVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCD--IQGCDK---- 73
             RV  +S E C   D YG +IK  MFCAG  +GG D+CQGDSGGP VC+  I G  +    
Sbjct:   312 RVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDRISGTSRWRLC 371

Query:    74 G-ASLGTD-RLSRACYVLSKMIRFYASVGIEATSSCSPGDPLTTTP 117
             G  S GT   L+R   V +K+I F   +  +A  + S    + T P
Sbjct:   372 GIVSWGTGCALARKPGVYTKVIDFREWI-FQAIKTHSEATGMVTQP 416




GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005044 "scavenger receptor activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0070008 "serine-type exopeptidase activity" evidence=IEA
UNIPROTKB|F1LY39 Hpn "Serine protease hepsin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LY41 Hpn "Serine protease hepsin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1196620 Hpn "hepsin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6R5 HPN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|61982 Hpn "hepsin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G1NYX6 HPN "Uncharacterized protein" [Myotis lucifugus (taxid:59463)] Back     alignment and assigned GO terms
UNIPROTKB|G1U4B0 HPN "Uncharacterized protein" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
RGD|735032 Klk1c3 "kallikrein 1-related peptidase C3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z1L4 HPN "cDNA FLJ57261, highly similar to Serine protease hepsin (EC 3.4.21.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35041TRY7_ANOGA3, ., 4, ., 2, 1, ., 40.54090.48760.2209yesN/A
O35453HEPS_MOUSE3, ., 4, ., 2, 1, ., 1, 0, 60.55350.46280.1284yesN/A
Q5R5E8HEPS_PONAB3, ., 4, ., 2, 1, ., 1, 0, 60.54710.43800.1270yesN/A
P05981HEPS_HUMAN3, ., 4, ., 2, 1, ., 1, 0, 60.54710.43800.1270yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 6e-18
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 9e-18
pfam00089218 pfam00089, Trypsin, Trypsin 5e-12
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 6e-18
 Identities = 27/65 (41%), Positives = 37/65 (56%)

Query: 7   SSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVC 66
           S        L+   V  +S   C++  +YG  I D+M CAG  +GG D+CQGDSGGP+VC
Sbjct: 133 SEGGPLPDVLQEVNVPIVSNAECKRAYSYGGTITDNMLCAGGLEGGKDACQGDSGGPLVC 192

Query: 67  DIQGC 71
           +  G 
Sbjct: 193 NDNGR 197


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG3627|consensus256 99.59
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.36
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.26
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.06
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.02
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 86.67
>KOG3627|consensus Back     alignment and domain information
Probab=99.59  E-value=3.5e-15  Score=106.14  Aligned_cols=91  Identities=32%  Similarity=0.583  Sum_probs=76.4

Q ss_pred             ccccccceEEEeccChhhhcccccCCCCcCCCeEEEeecCCCCCCccCCCcceEEEeeCCcccCceeEEEEeCCC-cc--
Q psy1243          11 SNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRA-CY--   87 (121)
Q Consensus        11 ~~~~~L~~~~l~~~~~~~C~~~~~~~~~~~~~~~Cag~~~~~~~~C~gDsGgPLv~~~~~~~~~~~~g~~~v~~~-~~--   87 (121)
                      ..+..||++.+++++...|+..+.....+.+.+|||+......++|+|||||||++....  .+...||++++.. |.  
T Consensus       157 ~~~~~L~~~~v~i~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~--~~~~~GivS~G~~~C~~~  234 (256)
T KOG3627|consen  157 PLPDTLQEVDVPIISNSECRRAYGGLGTITDTMLCAGGPEGGKDACQGDSGGPLVCEDNG--RWVLVGIVSWGSGGCGQP  234 (256)
T ss_pred             CCCceeEEEEEeEcChhHhcccccCccccCCCEEeeCccCCCCccccCCCCCeEEEeeCC--cEEEEEEEEecCCCCCCC
Confidence            568899999999999999999544332567779999965667789999999999999887  6778999999977 64  


Q ss_pred             ----eeeeccccceecceec
Q psy1243          88 ----VLSKMIRFYASVGIEA  103 (121)
Q Consensus        88 ----wi~~v~~~~~wi~~~~  103 (121)
                          .|+++..|.+||...+
T Consensus       235 ~~P~vyt~V~~y~~WI~~~~  254 (256)
T KOG3627|consen  235 NYPGVYTRVSSYLDWIKENI  254 (256)
T ss_pred             CCCeEEeEhHHhHHHHHHHh
Confidence                8999999999998654



>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 2e-10
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 2e-10
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 2e-10
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 2e-09
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 7e-09
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 8e-09
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 1e-08
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 1e-08
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 1e-08
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 1e-08
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-08
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 1e-08
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 1e-08
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 1e-08
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 1e-08
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 1e-08
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 1e-08
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 1e-08
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 1e-08
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 1e-08
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 1e-08
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 1e-08
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 1e-08
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 1e-08
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 1e-08
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 1e-08
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 1e-08
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 1e-08
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 1e-08
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 1e-08
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 1e-08
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 1e-08
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 1e-08
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 1e-08
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 1e-08
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 1e-08
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 1e-08
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 2e-08
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 2e-08
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 2e-08
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 3e-08
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 3e-08
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 3e-08
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 3e-08
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 3e-08
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 3e-08
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 3e-08
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 3e-08
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 3e-08
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 3e-08
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 3e-08
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 6e-08
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 7e-08
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 8e-08
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 8e-08
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 9e-08
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 9e-08
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 9e-08
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 9e-08
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 9e-08
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 9e-08
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 9e-08
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 9e-08
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 9e-08
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 1e-07
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-07
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-07
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 1e-07
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 1e-07
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 1e-07
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 1e-07
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 1e-07
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 1e-07
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 1e-07
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 1e-07
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 2e-07
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 2e-07
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 3e-07
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 3e-07
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 3e-07
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 3e-07
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 3e-07
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 3e-07
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 3e-07
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 3e-07
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 3e-07
2a31_A223 Trypsin In Complex With Borate Length = 223 3e-07
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 3e-07
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 3e-07
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 4e-07
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 4e-07
1dpo_A223 Structure Of Rat Trypsin Length = 223 4e-07
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 4e-07
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 4e-07
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 5e-07
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 5e-07
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 5e-07
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 5e-07
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 5e-07
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 5e-07
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 5e-07
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 5e-07
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 6e-07
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 6e-07
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 6e-07
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 6e-07
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 6e-07
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 6e-07
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 7e-07
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 7e-07
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 7e-07
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 7e-07
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 7e-07
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 7e-07
1pfx_C235 Porcine Factor Ixa Length = 235 8e-07
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 9e-07
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-06
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 1e-06
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 1e-06
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 1e-06
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 1e-06
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 1e-06
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-06
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-06
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 1e-06
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 1e-06
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 1e-06
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 1e-06
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 1e-06
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 1e-06
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 2e-06
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 2e-06
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 2e-06
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-06
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-06
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-06
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-06
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 3e-06
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 3e-06
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 3e-06
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 3e-06
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 3e-06
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 4e-06
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 4e-06
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 4e-06
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 5e-06
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 5e-06
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 7e-06
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 8e-06
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 8e-06
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 8e-06
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 8e-06
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 8e-06
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 8e-06
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 8e-06
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 8e-06
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 8e-06
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 9e-06
2any_A241 Expression, Crystallization And The Three-Dimension 1e-05
2anw_A241 Expression, Crystallization And Three-Dimensional S 1e-05
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 2e-05
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 2e-05
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 2e-05
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 3e-05
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 3e-05
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 4e-05
1elt_A236 Structure Of Native Pancreatic Elastase From North 4e-05
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 5e-05
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 5e-05
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 6e-05
1lto_A245 Human Alpha1-Tryptase Length = 245 6e-05
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 8e-05
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 8e-05
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 8e-05
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 8e-05
2xrc_A565 Human Complement Factor I Length = 565 1e-04
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 1e-04
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 1e-04
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 1e-04
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 2e-04
4gso_A232 Structure Of Jararacussin-I Length = 232 2e-04
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 2e-04
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 2e-04
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 2e-04
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 2e-04
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 3e-04
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 3e-04
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 3e-04
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 3e-04
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 3e-04
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 4e-04
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 5e-04
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 5e-04
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 8e-04
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 8e-04
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 8e-04
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 27/48 (56%), Positives = 33/48 (68%) Query: 20 RVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCD 67 RV +S + C D YG +IK MFCAG +GG D+CQGDSGGP VC+ Sbjct: 151 RVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE 198
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 2e-23
2r0l_A248 Hepatocyte growth factor activator; serine proteas 3e-23
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 9e-23
2jde_A276 Urokinase-type plasminogen activator; plasminogen 1e-22
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 2e-22
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 3e-22
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 8e-22
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 1e-21
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 2e-21
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-21
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 3e-21
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 4e-21
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 5e-21
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 9e-21
1ao5_A237 Glandular kallikrein-13; serine protease, protein 1e-20
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 1e-20
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 1e-20
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 1e-20
2asu_B234 Hepatocyte growth factor-like protein; serine prot 2e-20
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 2e-20
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 2e-20
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 2e-20
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 2e-20
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 3e-20
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 3e-20
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 3e-20
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-20
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 4e-20
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 4e-20
1aut_C250 Activated protein C; serine proteinase, plasma cal 4e-20
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 4e-20
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 5e-20
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 5e-20
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 5e-20
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 6e-20
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 1e-19
2aiq_A231 Protein C activator; snake venom serine proteinase 1e-19
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 1e-19
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 1e-19
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 2e-19
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 2e-19
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-19
3bg8_A238 Coagulation factor XIA light chain; protease inhib 3e-19
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 3e-19
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 4e-19
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 4e-19
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 4e-19
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 5e-19
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 6e-19
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 6e-19
1euf_A227 Duodenase; serine protease, dual specificity, hydr 8e-19
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 9e-19
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 1e-18
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 1e-18
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 1e-18
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 2e-18
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 5e-18
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 8e-18
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 2e-17
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 2e-17
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 3e-17
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 4e-17
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 4e-17
2qy0_B242 Complement C1R subcomponent; serine protease, beta 5e-17
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 7e-17
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 8e-17
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-16
1azz_A226 Collagenase; complex (serine protease/inhibitor), 1e-16
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 1e-16
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 2e-16
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 2e-16
1md8_A329 C1R complement serine protease; innate immunity, a 3e-16
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 3e-16
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 6e-16
1gpz_A399 Complement C1R component; hydrolase, activation, i 6e-16
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 6e-16
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 8e-16
1elv_A333 Complement C1S component; trypsin-like serin prote 2e-15
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 2e-15
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-15
1a7s_A225 Heparin binding protein; serine protease homolog, 1e-14
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 3e-14
2xxl_A408 GRAM-positive specific serine protease, isoform B; 5e-14
2odp_A509 Complement C2; C3/C5 convertase, complement serin 2e-13
2xrc_A565 Human complement factor I; immune system, hydrolas 2e-13
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 5e-13
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 9e-13
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 1e-12
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 1e-12
2z7f_E218 Leukocyte elastase; serine protease, serine protea 2e-12
3hrz_D741 Complement factor B; serine protease, glycosilated 2e-10
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
 Score = 89.6 bits (223), Expect = 2e-23
 Identities = 26/67 (38%), Positives = 34/67 (50%)

Query: 4   AIASSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGP 63
              S+       LK   V  +S   C++   YG+ +   M CA   Q   DSCQGDSGGP
Sbjct: 142 KENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGP 201

Query: 64  IVCDIQG 70
           +VC +QG
Sbjct: 202 LVCSLQG 208


>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.82
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.79
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.79
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.76
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.75
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.74
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.73
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.73
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.73
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.72
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.72
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.72
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.72
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.72
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.72
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.72
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.72
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.71
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.71
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.71
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.71
1elv_A333 Complement C1S component; trypsin-like serin prote 99.71
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.71
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.71
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.71
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.71
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.71
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.7
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.7
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.7
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.7
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.7
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.7
1md8_A329 C1R complement serine protease; innate immunity, a 99.7
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.7
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.7
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.7
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.7
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.7
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.7
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.7
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.69
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.69
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.69
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.69
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.69
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.69
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.68
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.68
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.68
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.68
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.68
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.68
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.67
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.67
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.67
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.67
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.67
2aiq_A231 Protein C activator; snake venom serine proteinase 99.67
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.67
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.67
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.67
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.67
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.66
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.66
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.66
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.66
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.66
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.65
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.65
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.65
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.65
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.65
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.64
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.64
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.63
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.63
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.63
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.63
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.62
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.61
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.61
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.6
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.59
1a7s_A225 Heparin binding protein; serine protease homolog, 99.57
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.57
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.56
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.52
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.51
2xrc_A565 Human complement factor I; immune system, hydrolas 99.5
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.47
3hrz_D741 Complement factor B; serine protease, glycosilated 99.44
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.43
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.42
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.92
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 98.67
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 98.3
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 97.7
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 97.69
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 97.63
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 97.6
2o8l_A274 V8 protease, taphylococcal serine; serine protease 97.58
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 97.26
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 96.45
1hpg_A187 Glutamic acid specific protease; serine protease, 96.18
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 95.94
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 94.99
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 92.58
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 92.44
3k6y_A237 Serine protease, possible membrane-associated seri 92.12
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 92.01
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 91.65
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 91.41
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 91.39
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 89.62
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 88.31
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 87.76
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 87.7
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 86.86
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 86.61
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 86.31
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 86.08
2aiq_A231 Protein C activator; snake venom serine proteinase 85.34
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 85.0
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 84.6
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 84.17
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 83.96
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 83.84
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 83.48
2oua_A188 Serine protease, protein NAPA; kinetic stability, 83.43
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 83.36
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 83.2
1elv_A333 Complement C1S component; trypsin-like serin prote 83.01
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 82.3
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 81.96
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 81.44
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 81.05
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 80.66
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 80.53
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 80.32
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 80.13
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
Probab=99.82  E-value=1.2e-20  Score=116.22  Aligned_cols=86  Identities=35%  Similarity=0.586  Sum_probs=72.5

Q ss_pred             cccccceEEEeccChhhhcccccCCCCcCCCeEEEeecCCCCCCccCCCcceEEEeeCCcccCceeEEEEeCCCcc----
Q psy1243          12 NALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQGCDKGASLGTDRLSRACY----   87 (121)
Q Consensus        12 ~~~~L~~~~l~~~~~~~C~~~~~~~~~~~~~~~Cag~~~~~~~~C~gDsGgPLv~~~~~~~~~~~~g~~~v~~~~~----   87 (121)
                      .++.||++.++++++++|++.|  ...+.++||||+  ..+.+.|.|||||||++...+  .+++.||+|++..|.    
T Consensus         3 ~~~~L~~~~v~i~~~~~C~~~~--~~~i~~~~iCa~--~~~~~~C~GDSGGPL~~~~~~--~~~l~GIvS~g~~c~~~~~   76 (97)
T 1yph_E            3 TPDRLQQASLPLLSNTNCKKYW--GTKIKDAMICAG--ASGVSSCMGDSGGPLVCKKNG--AWTLVGIVSWGSSTCSTST   76 (97)
T ss_dssp             CCSBCEEEEEEBCCHHHHHHHH--GGGCCTTEEEEE--CSSCBCCTTCTTCEEEEEETT--EEEEEEEEEECCTTCCTTS
T ss_pred             cCccceEEEEEECCHHHhhHHh--cCCCCCceEeec--CCCCCCCcCCCCCcEEEEeCC--eEEEEEEEEeCCCCCCCCC
Confidence            4678999999999999999854  345789999998  456789999999999998743  467899999987652    


Q ss_pred             --eeeeccccceecceec
Q psy1243          88 --VLSKMIRFYASVGIEA  103 (121)
Q Consensus        88 --wi~~v~~~~~wi~~~~  103 (121)
                        +|++|..|.+||...+
T Consensus        77 p~vyt~V~~y~~WI~~~~   94 (97)
T 1yph_E           77 PGVYARVTALVNWVQQTL   94 (97)
T ss_dssp             EEEEEEHHHHHHHHHHHH
T ss_pred             CeEEEEHHHhHHHHHHHH
Confidence              9999999999998654



>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 3e-12
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 1e-09
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 3e-09
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 3e-09
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 4e-09
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 8e-09
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 1e-08
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 3e-08
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 6e-08
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 7e-08
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 1e-07
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 1e-07
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 2e-07
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 4e-07
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 6e-07
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 1e-06
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 2e-06
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 2e-06
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 5e-06
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 5e-06
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 7e-06
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 1e-05
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 1e-05
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 2e-05
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 2e-05
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 3e-05
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 3e-05
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 5e-05
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 1e-04
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 5e-04
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 0.002
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 0.004
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.48
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.47
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.47
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.46
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.43
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.43
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.42
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.41
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.41
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.41
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.41
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.4
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.4
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.38
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.37
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.36
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.36
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.35
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.34
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.34
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.34
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.34
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.33
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.31
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.3
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.29
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.29
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.27
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.26
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.26
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.25
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.22
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.22
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.17
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.15
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.14
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.14
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.13
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.13
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.13
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.09
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.01
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.0
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.99
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 98.69
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 98.48
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 97.17
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 97.16
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 88.04
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 87.69
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 84.67
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 83.0
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 82.87
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 82.64
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 82.24
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 81.84
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 80.95
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Hepsin, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.48  E-value=8.9e-14  Score=95.61  Aligned_cols=98  Identities=36%  Similarity=0.585  Sum_probs=81.4

Q ss_pred             CCCCccccccceEEEeccChhhhcccccCCCCcCCCeEEEeecCCCCCCccCCCcceEEEeeC--CcccCceeEEEEeCC
Q psy1243           7 SSSASNALTLKAARVGTLSQESCRKEDAYGTRIKDSMFCAGSFQGGADSCQGDSGGPIVCDIQ--GCDKGASLGTDRLSR   84 (121)
Q Consensus         7 ~~~g~~~~~L~~~~l~~~~~~~C~~~~~~~~~~~~~~~Cag~~~~~~~~C~gDsGgPLv~~~~--~~~~~~~~g~~~v~~   84 (121)
                      ..++..+..|+...+++++++.|+..+.....+.+.++|++...++.+.|.||+||||++.+.  .-..+++.|++|++.
T Consensus       138 ~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~c~gdsGgPl~~~~~~~~~~~~~l~Gi~S~g~  217 (255)
T d1z8ga1         138 QYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGT  217 (255)
T ss_dssp             STTSCBCSBCEEEEEEEECHHHHTSTTTTTTCCCTTEEEESCTTCSCBCCTTCTTCEEEEEECTTSSCEEEEEEEEEEBS
T ss_pred             cCCCcccceeEEEEEEEeCHHHhhhhhccCccccCcceEEecCCCCcccccCccccceEEecCCCCCCcEEEEEEEEECC
Confidence            345667788999999999999999876666678888998887677788999999999999874  334567999999987


Q ss_pred             Ccc------eeeeccccceecceecc
Q psy1243          85 ACY------VLSKMIRFYASVGIEAT  104 (121)
Q Consensus        85 ~~~------wi~~v~~~~~wi~~~~~  104 (121)
                      .|.      +|+++..|.+||...+.
T Consensus       218 ~c~~~~~p~vft~V~~y~~WI~~~i~  243 (255)
T d1z8ga1         218 GCALAQKPGVYTKVSDFREWIFQAIK  243 (255)
T ss_dssp             SSSCTTCCEEEEEGGGGHHHHHHHHH
T ss_pred             CCCCCCCCEEEEEHHHhHHHHHHHHH
Confidence            774      79999999999987773



>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure