Diaphorina citri psyllid: psy12442

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MKQKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQ
cccccccccccEEccccccEEEEcccccccHHHHHHHHHcccEEEEEEccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccCEEcccccccccccHHHHcccccccccccccccccccccc
******R*APAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKS**********SCCLQKRRGAINSKQIAFL**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein tyrosine phosphatase type IVA 1 Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues.confidentQ63739
Protein tyrosine phosphatase type IVA 1 Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues.confidentQ5R7J8
Protein tyrosine phosphatase type IVA 1 Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.confidentQ93096

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partconfidentGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0035335 [BP]peptidyl-tyrosine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0004727 [MF]prenylated protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0004725, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0008138 [MF]protein tyrosine/serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RZ2, chain A
Confidence level:very confident
Coverage over the Query: 10-161
View the alignment between query and template
View the model in PyMOL