Psyllid ID: psy12442
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 208 | 2.2.26 [Sep-21-2011] | |||||||
| Q78EG7 | 173 | Protein tyrosine phosphat | yes | N/A | 0.798 | 0.959 | 0.583 | 8e-55 | |
| Q63739 | 173 | Protein tyrosine phosphat | yes | N/A | 0.798 | 0.959 | 0.583 | 8e-55 | |
| Q9TSM6 | 173 | Protein tyrosine phosphat | N/A | N/A | 0.798 | 0.959 | 0.583 | 8e-55 | |
| Q93096 | 173 | Protein tyrosine phosphat | yes | N/A | 0.798 | 0.959 | 0.583 | 8e-55 | |
| Q5R7J8 | 173 | Protein tyrosine phosphat | yes | N/A | 0.798 | 0.959 | 0.583 | 2e-54 | |
| A2VDT1 | 173 | Protein tyrosine phosphat | no | N/A | 0.798 | 0.959 | 0.553 | 3e-51 | |
| Q6P9X4 | 167 | Protein tyrosine phosphat | no | N/A | 0.793 | 0.988 | 0.560 | 8e-51 | |
| O70274 | 167 | Protein tyrosine phosphat | no | N/A | 0.793 | 0.988 | 0.560 | 8e-51 | |
| Q12974 | 167 | Protein tyrosine phosphat | no | N/A | 0.793 | 0.988 | 0.560 | 8e-51 | |
| Q9D658 | 173 | Protein tyrosine phosphat | no | N/A | 0.798 | 0.959 | 0.541 | 2e-50 |
| >sp|Q78EG7|TP4A1_RAT Protein tyrosine phosphatase type IVA 1 OS=Rattus norvegicus GN=Ptp4a1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 213 bits (542), Expect = 8e-55, Method: Compositional matrix adjust.
Identities = 98/168 (58%), Positives = 127/168 (75%), Gaps = 2/168 (1%)
Query: 7 RPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINV 66
RPAP E+ +K +FLIT PT+ T+ +I ELKK+ V +VRVCE TY ++ EGI+V
Sbjct: 6 RPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHV 65
Query: 67 KDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLK 126
D ++DG PS ++VD+W +K FRE+P C+AVHCVAGLGRAPV+VALALIE G+K
Sbjct: 66 LDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMK 125
Query: 127 YEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLK--NGQKNSCCLQ 172
YEDAV+ IRQKRRGA NSKQ+ +LEKY+PK RL+ K NG +N+CC+Q
Sbjct: 126 YEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ 173
|
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Rattus norvegicus (taxid: 10116) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8 |
| >sp|Q63739|TP4A1_MOUSE Protein tyrosine phosphatase type IVA 1 OS=Mus musculus GN=Ptp4a1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9TSM6|TP4A1_MACFA Protein tyrosine phosphatase type IVA 1 OS=Macaca fascicularis GN=PTP4A1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q93096|TP4A1_HUMAN Protein tyrosine phosphatase type IVA 1 OS=Homo sapiens GN=PTP4A1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R7J8|TP4A1_PONAB Protein tyrosine phosphatase type IVA 1 OS=Pongo abelii GN=PTP4A1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2VDT1|TP4A3_BOVIN Protein tyrosine phosphatase type IVA 3 OS=Bos taurus GN=PTP4A3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6P9X4|TP4A2_RAT Protein tyrosine phosphatase type IVA 2 OS=Rattus norvegicus GN=Ptp4a2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O70274|TP4A2_MOUSE Protein tyrosine phosphatase type IVA 2 OS=Mus musculus GN=Ptp4a2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q12974|TP4A2_HUMAN Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens GN=PTP4A2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9D658|TP4A3_MOUSE Protein tyrosine phosphatase type IVA 3 OS=Mus musculus GN=Ptp4a3 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 208 | ||||||
| 340719872 | 175 | PREDICTED: protein tyrosine phosphatase | 0.826 | 0.982 | 0.790 | 1e-74 | |
| 350415946 | 175 | PREDICTED: protein tyrosine phosphatase | 0.826 | 0.982 | 0.790 | 1e-74 | |
| 345494115 | 175 | PREDICTED: protein tyrosine phosphatase | 0.826 | 0.982 | 0.784 | 4e-74 | |
| 307181237 | 172 | Protein tyrosine phosphatase type IVA 1 | 0.826 | 1.0 | 0.779 | 4e-74 | |
| 383862800 | 175 | PREDICTED: protein tyrosine phosphatase | 0.826 | 0.982 | 0.784 | 5e-74 | |
| 332019900 | 181 | Protein tyrosine phosphatase type IVA 1 | 0.865 | 0.994 | 0.75 | 5e-74 | |
| 328780636 | 175 | PREDICTED: protein tyrosine phosphatase | 0.826 | 0.982 | 0.779 | 9e-74 | |
| 322783490 | 175 | hypothetical protein SINV_07755 [Solenop | 0.826 | 0.982 | 0.779 | 1e-73 | |
| 242025542 | 182 | protein tyrosine phosphatase type IVA pr | 0.822 | 0.939 | 0.754 | 7e-73 | |
| 237858779 | 178 | protein tyrosine phosphatase type IVA, m | 0.826 | 0.966 | 0.732 | 1e-72 |
| >gi|340719872|ref|XP_003398369.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 284 bits (727), Expect = 1e-74, Method: Compositional matrix adjust.
Identities = 136/172 (79%), Positives = 150/172 (87%)
Query: 1 MKQKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLK 60
M+ KDIRP PAEIE+K KFLITDRP D TI +I ELKKH VK VVRVCEPTYKVE+LK
Sbjct: 4 MRVKDIRPEPAEIEYKNMKFLITDRPNDQTIHTFIQELKKHNVKEVVRVCEPTYKVEELK 63
Query: 61 TEGINVKDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALAL 120
TEGINV DL ++DGT P E++DEWFE LK+ FRE PD CVAVHCVAGLGRAPV+VALAL
Sbjct: 64 TEGINVIDLVFDDGTFPPNEVIDEWFELLKNRFRESPDACVAVHCVAGLGRAPVLVALAL 123
Query: 121 IELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQ 172
IELGLKYEDAV LIR KRRGAINSKQ+A+LEKY+PKSRLKLKNGQKNSCC+Q
Sbjct: 124 IELGLKYEDAVALIRDKRRGAINSKQLAYLEKYRPKSRLKLKNGQKNSCCIQ 175
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350415946|ref|XP_003490800.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345494115|ref|XP_001603053.2| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307181237|gb|EFN68934.1| Protein tyrosine phosphatase type IVA 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383862800|ref|XP_003706871.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332019900|gb|EGI60361.1| Protein tyrosine phosphatase type IVA 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328780636|ref|XP_393167.4| PREDICTED: protein tyrosine phosphatase type IVA 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|322783490|gb|EFZ10954.1| hypothetical protein SINV_07755 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|242025542|ref|XP_002433183.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] gi|212518724|gb|EEB20445.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|237858779|ref|NP_001153821.1| protein tyrosine phosphatase type IVA, member 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 208 | ||||||
| FB|FBgn0024734 | 178 | PRL-1 "PRL-1" [Drosophila mela | 0.826 | 0.966 | 0.706 | 8.5e-65 | |
| UNIPROTKB|Q5ZIQ1 | 173 | PTP4A1 "Uncharacterized protei | 0.798 | 0.959 | 0.601 | 2.7e-52 | |
| UNIPROTKB|G5E526 | 173 | PTP4A1 "Uncharacterized protei | 0.798 | 0.959 | 0.583 | 1.9e-51 | |
| UNIPROTKB|F6Y8J4 | 173 | PTP4A1 "Uncharacterized protei | 0.798 | 0.959 | 0.583 | 3.1e-51 | |
| UNIPROTKB|Q93096 | 173 | PTP4A1 "Protein tyrosine phosp | 0.798 | 0.959 | 0.583 | 3.1e-51 | |
| MGI|MGI:1277096 | 173 | Ptp4a1 "protein tyrosine phosp | 0.798 | 0.959 | 0.583 | 3.1e-51 | |
| RGD|61970 | 173 | Ptp4a1 "protein tyrosine phosp | 0.798 | 0.959 | 0.583 | 3.1e-51 | |
| ZFIN|ZDB-GENE-041121-11 | 269 | ptp4a1 "protein tyrosine phosp | 0.793 | 0.613 | 0.586 | 3.6e-50 | |
| UNIPROTKB|F1NXK8 | 181 | PTP4A3 "Uncharacterized protei | 0.793 | 0.911 | 0.562 | 8.5e-49 | |
| UNIPROTKB|F1NLG3 | 174 | PTP4A2 "Uncharacterized protei | 0.793 | 0.948 | 0.566 | 1.4e-48 |
| FB|FBgn0024734 PRL-1 "PRL-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 660 (237.4 bits), Expect = 8.5e-65, P = 8.5e-65
Identities = 123/174 (70%), Positives = 151/174 (86%)
Query: 1 MKQKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLK 60
M+QKD+RPAPA IE+KG KFLITDRP+D+TI +YI+ELKK+ V VVRVCEP+Y ++L+
Sbjct: 5 MRQKDLRPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELE 64
Query: 61 TEGINVKDLAYEDGTSPSPELVDEWFEFLKSVFR--EDPDTCVAVHCVAGLGRAPVMVAL 118
T+GI VKDLA+EDGT P ++VDEWFEF ++R ++P+ CVAVHCVAGLGRAPV+VAL
Sbjct: 65 TQGITVKDLAFEDGTFPPQQVVDEWFEFFVVLYRYQQNPEACVAVHCVAGLGRAPVLVAL 124
Query: 119 ALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLKNGQKNSCCLQ 172
ALIELGLKYE AVE+IR KRRGAIN+KQ++FLEKYKPK+RLK KNG KNSC +Q
Sbjct: 125 ALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARLKHKNGHKNSCSVQ 178
|
|
| UNIPROTKB|Q5ZIQ1 PTP4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E526 PTP4A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6Y8J4 PTP4A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q93096 PTP4A1 "Protein tyrosine phosphatase type IVA 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1277096 Ptp4a1 "protein tyrosine phosphatase 4a1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61970 Ptp4a1 "protein tyrosine phosphatase type IVA, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041121-11 ptp4a1 "protein tyrosine phosphatase type IVA, member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXK8 PTP4A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLG3 PTP4A2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q63739 | TP4A1_MOUSE | 3, ., 1, ., 3, ., 4, 8 | 0.5833 | 0.7980 | 0.9595 | yes | N/A |
| Q54DU9 | TP4AA_DICDI | 3, ., 1, ., 3, ., 4, 8 | 0.4829 | 0.7019 | 0.8795 | yes | N/A |
| Q78EG7 | TP4A1_RAT | 3, ., 1, ., 3, ., 4, 8 | 0.5833 | 0.7980 | 0.9595 | yes | N/A |
| Q5R7J8 | TP4A1_PONAB | 3, ., 1, ., 3, ., 4, 8 | 0.5833 | 0.7980 | 0.9595 | yes | N/A |
| Q93096 | TP4A1_HUMAN | 3, ., 1, ., 3, ., 4, 8 | 0.5833 | 0.7980 | 0.9595 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.921 |
| 3rd Layer | 3.1.3.48 | 0.914 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 208 | |||
| PTZ00242 | 166 | PTZ00242, PTZ00242, protein tyrosine phosphatase; | 3e-66 | |
| PTZ00393 | 241 | PTZ00393, PTZ00393, protein tyrosine phosphatase; | 7e-45 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-10 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 2e-09 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 1e-08 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 1e-08 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 3e-07 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 2e-06 | |
| PRK12361 | 547 | PRK12361, PRK12361, hypothetical protein; Provisio | 9e-05 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 9e-05 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 0.001 |
| >gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Score = 201 bits (512), Expect = 3e-66
Identities = 73/158 (46%), Positives = 101/158 (63%), Gaps = 3/158 (1%)
Query: 6 IRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGIN 65
I +IE+ FKFLI D P+ +P YI EL+++ V ++VRVC PTY E L+ GI
Sbjct: 4 IECKDRQIEYVLFKFLILDAPSPSNLPLYIKELQRYNVTHLVRVCGPTYDAELLEKNGIE 63
Query: 66 VKDLAYEDGTSPSPELVDEWFEFLKSVFRED--PDTCVAVHCVAGLGRAPVMVALALIEL 123
V D ++DG P ++D W L F + P +AVHCVAGLGRAP++VALAL+E
Sbjct: 64 VHDWPFDDGAPPPKAVIDNWLRLLDQEFAKQSTPPETIAVHCVAGLGRAPILVALALVEY 123
Query: 124 G-LKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLK 160
G ++ DAV +R+KR+GAIN Q+ FL+KYKP+ +
Sbjct: 124 GGMEPLDAVGFVREKRKGAINQTQLQFLKKYKPRKKAA 161
|
Length = 166 |
| >gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 208 | |||
| KOG2836|consensus | 173 | 100.0 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 100.0 | |
| KOG1720|consensus | 225 | 99.93 | ||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.93 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.92 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.91 | |
| KOG1718|consensus | 198 | 99.9 | ||
| PRK12361 | 547 | hypothetical protein; Provisional | 99.88 | |
| KOG1719|consensus | 183 | 99.86 | ||
| KOG1717|consensus | 343 | 99.85 | ||
| KOG1716|consensus | 285 | 99.84 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.83 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.81 | |
| KOG2283|consensus | 434 | 99.8 | ||
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.79 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.78 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 99.78 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 99.77 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.77 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 99.76 | |
| KOG0792|consensus | 1144 | 99.75 | ||
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.72 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.72 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.64 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 99.62 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.61 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.61 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.61 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.57 | |
| KOG0793|consensus | 1004 | 99.54 | ||
| KOG0791|consensus | 374 | 99.54 | ||
| KOG0790|consensus | 600 | 99.48 | ||
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.43 | |
| KOG4228|consensus | 1087 | 99.43 | ||
| KOG4228|consensus | 1087 | 99.34 | ||
| PLN02727 | 986 | NAD kinase | 99.34 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.33 | |
| KOG0789|consensus | 415 | 99.23 | ||
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.05 | |
| KOG2386|consensus | 393 | 99.02 | ||
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 99.01 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.98 | |
| KOG1572|consensus | 249 | 98.98 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.42 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 97.04 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 96.71 | |
| KOG4471|consensus | 717 | 95.79 | ||
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 95.28 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 94.26 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 92.99 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 92.26 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 92.0 | |
| PRK01415 | 247 | hypothetical protein; Validated | 92.0 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 91.69 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 91.66 | |
| KOG1089|consensus | 573 | 90.91 | ||
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 90.41 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 89.7 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 89.64 | |
| KOG1530|consensus | 136 | 87.4 | ||
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 86.83 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 84.49 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 82.37 | |
| KOG2836|consensus | 173 | 81.64 | ||
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 81.03 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 80.51 |
| >KOG2836|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-43 Score=248.73 Aligned_cols=170 Identities=62% Similarity=1.085 Sum_probs=160.4
Q ss_pred CCCCCCCceeeeeeCceEEEeCCCCCCCHHHHHHHHHhCCCcEEEEecCCCCCccccccCCeEEEEeecCCCCCCCHHHH
Q psy12442 3 QKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELV 82 (208)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~g~~~~~~p~~d~~~p~~~~~ 82 (208)
++|+||+|++|+|+++||++|.+|.+.++..++++|+++|+++||.+|+..|+...++..|+.++.||.+|+.+|+.+.+
T Consensus 2 a~mnrPAPveIsy~~MrFLIThnPtnaTln~fieELkKygvttvVRVCe~TYdt~~lek~GI~Vldw~f~dg~ppp~qvv 81 (173)
T KOG2836|consen 2 ARMNRPAPVEISYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEPTYDTTPLEKEGITVLDWPFDDGAPPPNQVV 81 (173)
T ss_pred CcccCCCCeeeeccceEEEEecCCCchhHHHHHHHHHhcCCeEEEEecccccCCchhhhcCceEeecccccCCCCchHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhhhCCCCcEEEEcCCCCCcHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHhHhhhhhhc
Q psy12442 83 DEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLK 162 (208)
Q Consensus 83 ~~~~~~i~~~l~~~~~~~vlVHC~~G~~RSg~~~~~~l~~~~~~~~~a~~~vr~~R~~~~~~~q~~~l~~~~~~~~~~~~ 162 (208)
.++.+.+...+++.++..|.|||.+|+||...++|..|++.||..++|++++|++|.
T Consensus 82 ~~w~~l~~~~f~e~p~~cvavhcvaglgrapvlvalalie~gmkyedave~ir~krr----------------------- 138 (173)
T KOG2836|consen 82 DDWLSLVKTKFREEPGCCVAVHCVAGLGRAPVLVALALIEAGMKYEDAVEMIRQKRR----------------------- 138 (173)
T ss_pred HHHHHHHHHHHhhCCCCeEEEEeecccCcchHHHHHHHHHccccHHHHHHHHHHHhh-----------------------
Confidence 999998887777888999999999999999999999999999999999999988764
Q ss_pred cCCCCcchhhhhhccccchhhhhhhhcCCcccccccC--CCCCCcccC
Q psy12442 163 NGQKNSCCLQKRRGAINSKQIAFLEKYKPKSRLKLKN--GQKNSCCLQ 208 (208)
Q Consensus 163 ~~~~~~~~~~~~~~~~~~k~i~~~~~~~~k~rl~~~~--~~~~~~~~~ 208 (208)
|++|++|+.|+++|+||.|||+++ ||+++||||
T Consensus 139 -------------ga~n~kql~~lekyrpk~rlr~k~~~gh~~~ccvq 173 (173)
T KOG2836|consen 139 -------------GAINSKQLLYLEKYRPKMRLRFKDPNGHKNSCCVQ 173 (173)
T ss_pred -------------ccccHHHHHHHHHhCccceeeccCCCCCccccccC
Confidence 456688899999999999999985 889999998
|
|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >KOG1530|consensus | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 208 | ||||
| 1xm2_A | 173 | Crystal Structure Of Human Prl-1 Length = 173 | 4e-54 | ||
| 3rz2_A | 189 | Crystal Of Prl-1 Complexed With Peptide Length = 18 | 4e-53 | ||
| 1x24_A | 180 | Prl-1 (Ptp4a) Length = 180 | 2e-51 | ||
| 1v3a_A | 173 | Structure Of Human Prl-3, The Phosphatase Associate | 4e-51 | ||
| 1rxd_A | 159 | Crystal Structure Of Human Protein Tyrosine Phospha | 1e-50 | ||
| 1zcl_A | 180 | Prl-1 C104s Mutant In Complex With Sulfate Length = | 2e-50 | ||
| 1r6h_A | 172 | Solution Structure Of Human Prl-3 Length = 172 | 4e-50 | ||
| 1zck_A | 154 | Native Structure Prl-1 (Ptp4a1) Length = 154 | 6e-50 | ||
| 3s4o_A | 167 | Protein Tyrosine Phosphatase (Putative) From Leishm | 2e-31 | ||
| 1ohc_A | 348 | Structure Of The Proline Directed Phosphatase Cdc14 | 4e-10 | ||
| 1ohe_A | 348 | Structure Of Cdc14b Phosphatase With A Peptide Liga | 6e-09 | ||
| 2i6i_A | 161 | Crystal Structures Of The Archaeal Sulfolobus Ptp-F | 4e-06 | ||
| 4erc_A | 150 | Structure Of Vhz Bound To Metavanadate Length = 150 | 1e-05 | ||
| 2dxp_A | 161 | Crystal Structure Of The Complex Of The Archaeal Su | 5e-05 | ||
| 1d5r_A | 324 | Crystal Structure Of The Pten Tumor Suppressor Leng | 7e-05 | ||
| 2img_A | 151 | Crystal Structure Of Dual Specificity Protein Phosp | 7e-05 | ||
| 3f41_A | 629 | Structure Of The Tandemly Repeated Protein Tyrosine | 2e-04 |
| >pdb|1XM2|A Chain A, Crystal Structure Of Human Prl-1 Length = 173 | Back alignment and structure |
|
| >pdb|3RZ2|A Chain A, Crystal Of Prl-1 Complexed With Peptide Length = 189 | Back alignment and structure |
| >pdb|1X24|A Chain A, Prl-1 (Ptp4a) Length = 180 | Back alignment and structure |
| >pdb|1V3A|A Chain A, Structure Of Human Prl-3, The Phosphatase Associated With Cancer Metastasis Length = 173 | Back alignment and structure |
| >pdb|1RXD|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 4a1 Length = 159 | Back alignment and structure |
| >pdb|1ZCL|A Chain A, Prl-1 C104s Mutant In Complex With Sulfate Length = 180 | Back alignment and structure |
| >pdb|1R6H|A Chain A, Solution Structure Of Human Prl-3 Length = 172 | Back alignment and structure |
| >pdb|1ZCK|A Chain A, Native Structure Prl-1 (Ptp4a1) Length = 154 | Back alignment and structure |
| >pdb|3S4O|A Chain A, Protein Tyrosine Phosphatase (Putative) From Leishmania Major Length = 167 | Back alignment and structure |
| >pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 | Back alignment and structure |
| >pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 | Back alignment and structure |
| >pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 | Back alignment and structure |
| >pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 | Back alignment and structure |
| >pdb|2DXP|A Chain A, Crystal Structure Of The Complex Of The Archaeal Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides A-(P)y-R Length = 161 | Back alignment and structure |
| >pdb|1D5R|A Chain A, Crystal Structure Of The Pten Tumor Suppressor Length = 324 | Back alignment and structure |
| >pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 | Back alignment and structure |
| >pdb|3F41|A Chain A, Structure Of The Tandemly Repeated Protein Tyrosine Phosphatase Like Phytase From Mitsuokella Multacida Length = 629 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
Score = 177 bits (451), Expect = 5e-57
Identities = 95/164 (57%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
Query: 7 RPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINV 66
RPAP E+ +K +FLIT PT+ T+ +I ELKK+ V +VRVCE TY ++ EGI+V
Sbjct: 26 RPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHV 85
Query: 67 KDLAYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLK 126
D ++DG PS ++VD+W +K FRE+P C+AVHCVAGLGRAPV+VALALIE G+K
Sbjct: 86 LDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMK 145
Query: 127 YEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLK--NGQKNS 168
YEDAV+ IRQKRRGA NSKQ+ +LEKY+PK RL+ K NG +N+
Sbjct: 146 YEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNN 189
|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 208 | |||
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 100.0 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 100.0 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 100.0 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.96 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.95 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.94 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.94 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.94 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.94 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.94 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.94 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.94 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.94 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.93 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.93 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.93 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.93 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.93 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.93 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.93 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.92 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.92 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.92 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.92 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.92 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.92 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.92 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.92 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.92 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.91 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.9 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.9 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.89 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.88 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.88 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.87 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.86 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.83 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.83 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.83 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.82 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.82 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.82 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.82 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.82 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.82 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.82 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.82 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.82 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.82 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.82 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.82 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.81 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.81 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.81 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.81 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.81 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.81 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.8 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.8 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.8 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.8 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.79 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.78 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.78 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.78 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.78 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 99.77 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.77 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.77 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.76 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.76 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.74 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.73 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.73 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.7 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.7 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.69 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.51 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.48 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.45 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.25 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.2 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.43 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 95.47 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 92.65 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 92.42 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 91.89 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 90.68 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 87.95 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 83.7 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 82.55 |
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-38 Score=242.50 Aligned_cols=163 Identities=56% Similarity=0.995 Sum_probs=145.2
Q ss_pred CCCCCCCceeeeeeCceEEEeCCCCCCCHHHHHHHHHhCCCcEEEEecCCCCCccccccCCeEEEEeecCCCCCCCHHHH
Q psy12442 3 QKDIRPAPAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELV 82 (208)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~g~~~~~~p~~d~~~p~~~~~ 82 (208)
+.|+.|++++++|++.+||++++|++.+++++++.|+++||++||+|++..|++..+...+++|++||++|+.+|..+.+
T Consensus 22 ~~m~~p~~~~~~~~~~r~I~tq~P~~~t~~~~~~~L~~~gi~~Iv~l~~~~~~~~~~~~~~i~~~~~pi~d~~~~~~~~~ 101 (189)
T 3rz2_A 22 ARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIV 101 (189)
T ss_dssp -------CCCEEETTEEEEEECCCCTTTHHHHHHHHHTTTEEEEEECSCCCSCCHHHHHSSCEEEECCCCSSSCCCSHHH
T ss_pred hccCCCCCeeeecCCCeEEEeCCCCcccHHHHHHHHHHcCCcEEEEeCCCcCCHHHHHHcCcEEEEecCCCCCCCCHHHH
Confidence 56999999999999999999999999999999999999999999999998888888888899999999999989998999
Q ss_pred HHHHHHHHhhhhhCCCCcEEEEcCCCCCcHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHhHhhhhhhc
Q psy12442 83 DEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKLK 162 (208)
Q Consensus 83 ~~~~~~i~~~l~~~~~~~vlVHC~~G~~RSg~~~~~~l~~~~~~~~~a~~~vr~~R~~~~~~~q~~~l~~~~~~~~~~~~ 162 (208)
.++++++++++...+++||+|||.+|+||||+++++|||..|++.++|++.+|++|++++++.|++||++|+..++++++
T Consensus 102 ~~~~~~i~~~~~~~~~~~VlVHC~aG~gRSg~~va~~L~~~g~~~~~a~~~vr~~R~~~v~~~Q~~~l~~~~~~lrlr~~ 181 (189)
T 3rz2_A 102 DDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFK 181 (189)
T ss_dssp HHHHHHHHHHHHHSTTCEEEEECSSSSTTHHHHHHHHHHTTTCCHHHHHHHHHTTSSSCCCHHHHHHHHHCCCCCCCCC-
T ss_pred HHHHHHHHHHHHhCCCCcEEEECCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHCcCCCCHHHHHHHHHHHHHhccccc
Confidence 99999999887666789999999999999999999999999999999999999999999999999999999999999888
Q ss_pred cCC
Q psy12442 163 NGQ 165 (208)
Q Consensus 163 ~~~ 165 (208)
++.
T Consensus 182 ~~~ 184 (189)
T 3rz2_A 182 DSN 184 (189)
T ss_dssp ---
T ss_pred ccc
Confidence 773
|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 208 | ||||
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 9e-46 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 4e-25 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 4e-20 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 5e-17 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 2e-15 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 1e-10 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 7e-09 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-07 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 7e-06 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 6e-04 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 7e-04 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 7e-04 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 0.001 |
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Protein tyrosine phosphatase type IVa species: Human (Homo sapiens), pr-1 [TaxId: 9606]
Score = 146 bits (370), Expect = 9e-46
Identities = 88/152 (57%), Positives = 114/152 (75%)
Query: 10 PAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDL 69
P E+ +K +FLIT PT+ T+ +I ELKK+ V +VRVCE TY ++ EGI+V D
Sbjct: 1 PVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDW 60
Query: 70 AYEDGTSPSPELVDEWFEFLKSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYED 129
++DG PS ++VD+W +K FRE+P C+AVHCVAGLGRAPV+VALALIE G+KYED
Sbjct: 61 PFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYED 120
Query: 130 AVELIRQKRRGAINSKQIAFLEKYKPKSRLKL 161
AV+ IRQKRRGA NSKQ+ +LEKY+PK RL+
Sbjct: 121 AVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRF 152
|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 208 | |||
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 100.0 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.97 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.96 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.93 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.93 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.93 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.92 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.92 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.81 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.8 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 99.79 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 99.79 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 99.78 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 99.78 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 99.78 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.77 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 99.77 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 99.77 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 99.75 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 99.75 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.43 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 99.26 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 96.92 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 92.65 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 92.28 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 89.17 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 88.52 |
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Protein tyrosine phosphatase type IVa species: Human (Homo sapiens), pr-1 [TaxId: 9606]
Probab=100.00 E-value=2.9e-38 Score=233.57 Aligned_cols=152 Identities=58% Similarity=1.028 Sum_probs=142.5
Q ss_pred ceeeeeeCceEEEeCCCCCCCHHHHHHHHHhCCCcEEEEecCCCCCccccccCCeEEEEeecCCCCCCCHHHHHHHHHHH
Q psy12442 10 PAEIEFKGFKFLITDRPTDLTIPNYILELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPELVDEWFEFL 89 (208)
Q Consensus 10 ~~~~~~~~~~~~~~~~p~~~~~~~~~~~l~~~gi~~Vv~l~~~~~~~~~~~~~g~~~~~~p~~d~~~p~~~~~~~~~~~i 89 (208)
|++++|++.+||+|++|.+.+..++|+.|+++||++||+|+++.|++..+...|++++++|++|+.+|+.+.+..++..+
T Consensus 1 ~~~~~y~~~rfI~tq~P~~~t~~~f~~~l~~~~i~~Iv~l~e~~y~~~~~~~~~i~~~~~~~~d~~~p~~~~~~~~~~~~ 80 (152)
T d1rxda_ 1 PVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLV 80 (152)
T ss_dssp CEEEEETTEEEEECCCCCGGGHHHHHHHHHHTTEEEEEECSCCCSCCHHHHHTTCEEEECCC--CCCCCHHHHHHHHHHH
T ss_pred CeeEeecCceEEEECCCCchhHHHHHHHHHHhCCeEEeecccccCCchheeecceEEEEeeCCCCCCCCHHHHHHHHHHH
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhhhhCCCCcEEEEcCCCCCcHHHHHHHHHHHcCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHhHhhhhhh
Q psy12442 90 KSVFREDPDTCVAVHCVAGLGRAPVMVALALIELGLKYEDAVELIRQKRRGAINSKQIAFLEKYKPKSRLKL 161 (208)
Q Consensus 90 ~~~l~~~~~~~vlVHC~~G~~RSg~~~~~~l~~~~~~~~~a~~~vr~~R~~~~~~~q~~~l~~~~~~~~~~~ 161 (208)
..++...++++|+|||.+|+||||+++|+||+..|++.++|++.+|++||+++++.|++||.+|+..+|+|+
T Consensus 81 ~~~~~~~~~~~v~VHC~~G~gRsg~~~a~~l~~~~~~~~~av~~vr~~R~~~i~~~Q~~fl~~y~~~~r~~~ 152 (152)
T d1rxda_ 81 KIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRF 152 (152)
T ss_dssp HHHHHHSTTCEEEEECSSSSTTHHHHHHHHHHHTTCCHHHHHHHHHTTCTTCCCHHHHHHHHHCCCCCCCCC
T ss_pred HHHHHhCCCCCEEEEEcCCcccHHHHHHHHHHHhCcCHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHHhcC
Confidence 888877778999999999999999999999999999999999999999999999899999999999887653
|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|