Diaphorina citri psyllid: psy12448


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKAEDPIYVLENNVPIDSNYYLENQLSKPLIRIFSPILGDKAESILLRGDHTRTKIVSTSRVGALSMFVQKKQTCIGCKVVLHDTSLSNALCNFCLAKEKQYYEAENDKYQQLEKKFCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQSCGHNVKRARGVCMSK
ccccccHHHHHccccccHHHHHHHccccHHHHHHcccccccHHHHHHccccccccEEcccccccHHHHHHHcccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEHHHHHHHHHHHHHccccccc
**AEDPIYVLENNVPIDSNYYLENQLSKPLIRIFSPILGDKAESILLRGDHTRTKIVSTSRVGALSMFVQKKQTCIGCKVVLHDTSLSNALCNFCLAKEKQYYEAENDKYQQLEKKFCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQSCGHNVKRARGVCMS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAEDPIYVLENNVPIDSNYYLENQLSKPLIRIFSPILGDKAESILLRGDHTRTKIVSTSRVGALSMFVQKKQTCIGCKVVLHDTSLSNALCNFCxxxxxxxxxxxxxxxxxxxxxFCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQSCGHNVKRARGVCMSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase delta catalytic subunit This polymerase possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction.confidentP30316
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentP28340
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentO54747

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006287 [BP]base-excision repair, gap-fillingprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006284, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0044763
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0071897 [BP]DNA biosynthetic processprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006259, GO:0019438
GO:0000109 [CC]nucleotide-excision repair complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008296 [MF]3'-5'-exodeoxyribonuclease activityprobableGO:0016787, GO:0008408, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674, GO:0016895

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QHT, chain A
Confidence level:confident
Coverage over the Query: 1-39
View the alignment between query and template
View the model in PyMOL
Template: 3FLO, chain B
Confidence level:probable
Coverage over the Query: 71-142
View the alignment between query and template
View the model in PyMOL