Diaphorina citri psyllid: psy12460


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
ccccccccccccccccccEEccccccEEEHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcc
*PIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVS**********TSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA-processing factor 19 Plays a role in DNA double-strand break (DSB) repair. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process.confidentQ08E38
Pre-mRNA-processing factor 19 Plays a role in DNA double-strand break (DSB) repair. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process.confidentQ99KP6
Pre-mRNA-processing factor 19 Plays a role in DNA double-strand break (DSB) repair. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity.confidentQ5ZMA2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partconfidentGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000974 [CC]Prp19 complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0045665 [BP]negative regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008610 [BP]lipid biosynthetic processprobableGO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0048711 [BP]positive regulation of astrocyte differentiationprobableGO:0048710, GO:0030154, GO:0045687, GO:0050789, GO:0045685, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:0008150, GO:0065007, GO:0044699, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0034450 [MF]ubiquitin-ubiquitin ligase activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0000151 [CC]ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0001833 [BP]inner cell mass cell proliferationprobableGO:0032502, GO:0032501, GO:0044707, GO:0001701, GO:0040007, GO:0048589, GO:0008283, GO:0001832, GO:0001824, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699, GO:0048856
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000245 [BP]spliceosomal complex assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048026 [BP]positive regulation of mRNA splicing, via spliceosomeprobableGO:0080090, GO:0019222, GO:0050685, GO:0050684, GO:0031325, GO:0031323, GO:0048024, GO:0050789, GO:0009893, GO:0010604, GO:0043484, GO:0060255, GO:0065007, GO:0048518, GO:0010468, GO:0033120, GO:0045935, GO:0019219, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BAY, chain A
Confidence level:very confident
Coverage over the Query: 6-61
View the alignment between query and template
View the model in PyMOL
Template: 2LW1, chain A
Confidence level:probable
Coverage over the Query: 103-137
View the alignment between query and template
View the model in PyMOL