Psyllid ID: psy12460

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
ccccccccccccccccccEEccccccEEEHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEcc
ccccccEEEEccccccccEEccccccEHHHHHHHHHHHHccccccccccccHHHcEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccHHHccccccccEEEEEEcc
mpifgtktvmsnevpehpvvspisgsvFEKRLIEKYIKengtdpinaERLTLEQLIdikvspvtkpkppqatsiPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATlkpqagiatpttipqpsrlwgkfchsSVVVKVLTC
mpifgtktvmsnevpehpvvspisgsvfEKRLIEKYIkengtdpinaERLTLEQLIDIkvspvtkpkppqaTSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALatlkpqagiatpttipqpsrlwgkfchssvvvkvltc
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
**********************ISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVS***********SIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVL**
*PIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQL****************TSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAR***************************FCHSSVVVKVLTC
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
*PIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIFGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQPSRLWGKFCHSSVVVKVLTC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q9UMS4 504 Pre-mRNA-processing facto yes N/A 0.842 0.285 0.787 1e-61
Q08E38 504 Pre-mRNA-processing facto yes N/A 0.842 0.285 0.787 1e-61
Q9JMJ4 504 Pre-mRNA-processing facto yes N/A 0.842 0.285 0.787 2e-61
Q99KP6 504 Pre-mRNA-processing facto yes N/A 0.842 0.285 0.787 2e-61
Q5ZMA2 505 Pre-mRNA-processing facto yes N/A 0.824 0.279 0.780 1e-60
Q10051 492 Pre-mRNA-processing facto yes N/A 0.766 0.266 0.621 3e-44
Q9AV81 527 U-box domain-containing p yes N/A 0.812 0.263 0.558 6e-39
Q7KWK5 514 Pre-mRNA-processing facto yes N/A 0.754 0.250 0.542 1e-36
Q94BR4 523 Pre-mRNA-processing facto yes N/A 0.766 0.250 0.541 1e-34
O22785 525 Pre-mRNA-processing facto no N/A 0.754 0.245 0.534 2e-34
>sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 Back     alignment and function desciption
 Score =  234 bits (598), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 126/146 (86%), Gaps = 2/146 (1%)

Query: 10  MSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPP 69
           +SNEVPEHP VSP+S  V+E+RLIEKYI ENGTDPIN + L+ EQLIDIKV+   +PKPP
Sbjct: 7   ISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPP 66

Query: 70  QATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTA 129
            ATSIPAILK LQDEWDA+MLHSFT RQQLQT RQELSHALYQHDAACRVIARLTKEVTA
Sbjct: 67  SATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTA 126

Query: 130 AREALATLKPQAGIATPTTIP--QPS 153
           AREALATLKPQAG+  P  +P  QPS
Sbjct: 127 AREALATLKPQAGLIVPQAVPSSQPS 152
Plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.
Homo sapiens (taxid: 9606)
>sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 Back     alignment and function description
>sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=2 SV=2 Back     alignment and function description
>sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 Back     alignment and function description
>sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 homolog OS=Caenorhabditis elegans GN=T10F2.4 PE=3 SV=2 Back     alignment and function description
>sp|Q9AV81|PUB72_ORYSJ U-box domain-containing protein 72 OS=Oryza sativa subsp. japonica GN=PUB72 PE=2 SV=1 Back     alignment and function description
>sp|Q7KWK5|PRP19_DICDI Pre-mRNA-processing factor 19 homolog OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1 Back     alignment and function description
>sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 Back     alignment and function description
>sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
307178212 504 Pre-mRNA-processing factor 19 [Camponotu 0.842 0.285 0.826 3e-66
328723776 513 PREDICTED: pre-mRNA-processing factor 19 0.842 0.280 0.802 3e-66
193657225 509 PREDICTED: pre-mRNA-processing factor 19 0.836 0.280 0.807 4e-66
307205555 504 Pre-mRNA-processing factor 19 [Harpegnat 0.842 0.285 0.812 3e-65
383852262 504 PREDICTED: pre-mRNA-processing factor 19 0.842 0.285 0.812 4e-65
66513511 504 PREDICTED: pre-mRNA-processing factor 19 0.842 0.285 0.826 5e-65
380030253 504 PREDICTED: pre-mRNA-processing factor 19 0.842 0.285 0.826 5e-65
340711277 504 PREDICTED: pre-mRNA-processing factor 19 0.842 0.285 0.819 5e-65
156547225 289 PREDICTED: pre-mRNA-processing factor 19 0.836 0.494 0.812 1e-64
332024009 503 Pre-mRNA-processing factor 19 [Acromyrme 0.836 0.284 0.812 2e-64
>gi|307178212|gb|EFN66997.1| Pre-mRNA-processing factor 19 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/144 (82%), Positives = 131/144 (90%)

Query: 10  MSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPP 69
           +SNEVPEHPVVSP+SGS+FE+RL+EKY+ ENG DPIN + LT+EQLIDIK +P+ KPKPP
Sbjct: 7   ISNEVPEHPVVSPVSGSIFERRLVEKYVAENGVDPINGKELTIEQLIDIKTTPIVKPKPP 66

Query: 70  QATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTA 129
            ATSIPAILK LQDEWDA+MLHSFT RQQLQTARQELSHALYQHDAACRVIARLTKEVTA
Sbjct: 67  SATSIPAILKNLQDEWDAVMLHSFTLRQQLQTARQELSHALYQHDAACRVIARLTKEVTA 126

Query: 130 AREALATLKPQAGIATPTTIPQPS 153
           AREALATLKPQAGI    TIPQP+
Sbjct: 127 AREALATLKPQAGIVQAATIPQPA 150

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328723776|ref|XP_003247938.1| PREDICTED: pre-mRNA-processing factor 19-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193657225|ref|XP_001948045.1| PREDICTED: pre-mRNA-processing factor 19-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307205555|gb|EFN83860.1| Pre-mRNA-processing factor 19 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383852262|ref|XP_003701647.1| PREDICTED: pre-mRNA-processing factor 19 [Megachile rotundata] Back     alignment and taxonomy information
>gi|66513511|ref|XP_392284.2| PREDICTED: pre-mRNA-processing factor 19 [Apis mellifera] Back     alignment and taxonomy information
>gi|380030253|ref|XP_003698766.1| PREDICTED: pre-mRNA-processing factor 19 [Apis florea] Back     alignment and taxonomy information
>gi|340711277|ref|XP_003394205.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus terrestris] gi|350411998|ref|XP_003489512.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156547225|ref|XP_001604701.1| PREDICTED: pre-mRNA-processing factor 19-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332024009|gb|EGI64227.1| Pre-mRNA-processing factor 19 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
UNIPROTKB|Q08E38 504 PRPF19 "Pre-mRNA-processing fa 0.842 0.285 0.787 1.2e-56
UNIPROTKB|E2R8L3 513 PRPF19 "Uncharacterized protei 0.842 0.280 0.787 1.2e-56
UNIPROTKB|F5GY56252 PRPF19 "Pre-mRNA-processing fa 0.842 0.571 0.787 1.2e-56
UNIPROTKB|Q9UMS4 504 PRPF19 "Pre-mRNA-processing fa 0.842 0.285 0.787 1.2e-56
UNIPROTKB|B2CCY7 504 PRPF19 "Nuclear matrix protein 0.842 0.285 0.787 1.2e-56
MGI|MGI:106247 504 Prpf19 "PRP19/PSO4 pre-mRNA pr 0.842 0.285 0.787 1.2e-56
RGD|708496 504 Prpf19 "PRP19/PSO4 pre-mRNA pr 0.842 0.285 0.787 1.2e-56
UNIPROTKB|Q9JMJ4 504 Prpf19 "Pre-mRNA-processing fa 0.842 0.285 0.787 1.2e-56
UNIPROTKB|Q5ZMA2 505 PRPF19 "Pre-mRNA-processing fa 0.842 0.285 0.767 6.8e-56
ZFIN|ZDB-GENE-030131-263 505 prp19 "PRP19/PSO4 homolog (S. 0.842 0.285 0.780 1.4e-55
UNIPROTKB|Q08E38 PRPF19 "Pre-mRNA-processing factor 19" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 583 (210.3 bits), Expect = 1.2e-56, P = 1.2e-56
 Identities = 115/146 (78%), Positives = 126/146 (86%)

Query:    10 MSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPP 69
             +SNEVPEHP VSP+S  V+E+RLIEKYI ENGTDPIN + L+ EQLIDIKV+   +PKPP
Sbjct:     7 ISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPP 66

Query:    70 QATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTA 129
              ATSIPAILK LQDEWDA+MLHSFT RQQLQT RQELSHALYQHDAACRVIARLTKEVTA
Sbjct:    67 SATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTA 126

Query:   130 AREALATLKPQAGIATPTTIP--QPS 153
             AREALATLKPQAG+  P  +P  QPS
Sbjct:   127 AREALATLKPQAGLIVPQAVPSSQPS 152
GO:0000974 "Prp19 complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0005819 "spindle" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IEA
GO:0048711 "positive regulation of astrocyte differentiation" evidence=IEA
GO:0048026 "positive regulation of mRNA splicing, via spliceosome" evidence=IEA
GO:0045665 "negative regulation of neuron differentiation" evidence=IEA
GO:0042802 "identical protein binding" evidence=IEA
GO:0034450 "ubiquitin-ubiquitin ligase activity" evidence=IEA
GO:0016607 "nuclear speck" evidence=IEA
GO:0008610 "lipid biosynthetic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IEA
GO:0001833 "inner cell mass cell proliferation" evidence=IEA
GO:0000245 "spliceosomal complex assembly" evidence=IEA
GO:0000209 "protein polyubiquitination" evidence=IEA
GO:0006281 "DNA repair" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0000151 "ubiquitin ligase complex" evidence=IEA
UNIPROTKB|E2R8L3 PRPF19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5GY56 PRPF19 "Pre-mRNA-processing factor 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UMS4 PRPF19 "Pre-mRNA-processing factor 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B2CCY7 PRPF19 "Nuclear matrix protein 200" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:106247 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708496 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9JMJ4 Prpf19 "Pre-mRNA-processing factor 19" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMA2 PRPF19 "Pre-mRNA-processing factor 19" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-263 prp19 "PRP19/PSO4 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94BR4PR19A_ARATH6, ., 3, ., 2, ., -0.54190.76600.2504yesN/A
Q08E38PRP19_BOVINNo assigned EC number0.78760.84210.2857yesN/A
Q5ZMA2PRP19_CHICKNo assigned EC number0.78010.82450.2792yesN/A
Q7KWK5PRP19_DICDINo assigned EC number0.54260.75430.2509yesN/A
Q99KP6PRP19_MOUSENo assigned EC number0.78760.84210.2857yesN/A
Q9UMS4PRP19_HUMANNo assigned EC number0.78760.84210.2857yesN/A
Q9JMJ4PRP19_RATNo assigned EC number0.78760.84210.2857yesN/A
Q9AV81PUB72_ORYSJ6, ., 3, ., 2, ., -0.55860.81280.2637yesN/A
Q10051PRP19_CAEELNo assigned EC number0.62120.76600.2662yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
pfam0860670 pfam08606, Prp19, Prp19/Pso4-like 2e-37
smart0050463 smart00504, Ubox, Modified RING finger domain 2e-13
>gnl|CDD|203998 pfam08606, Prp19, Prp19/Pso4-like Back     alignment and domain information 
 Score =  123 bits (310), Expect = 2e-37
 Identities = 50/70 (71%), Positives = 55/70 (78%)

Query: 69  PQATSIPAILKMLQDEWDAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVT 128
           P ATSIP++L  LQ+EWDAIML +F  R+QL   RQELSHALYQHDAACRVIARL KE  
Sbjct: 1   PTATSIPSLLSTLQNEWDAIMLETFELRKQLDQTRQELSHALYQHDAACRVIARLIKERD 60

Query: 129 AAREALATLK 138
            AREALA L 
Sbjct: 61  EAREALAELT 70

This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly. Length = 70
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG0289|consensus 506 100.0
PF0860670 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This r 100.0
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.68
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.64
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 99.25
KOG0883|consensus 518 99.18
KOG4642|consensus284 98.71
KOG0826|consensus357 98.64
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.31
PF04641260 Rtf2: Rtf2 RING-finger 98.1
KOG3039|consensus303 97.85
KOG0823|consensus230 97.82
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.82
KOG2979|consensus262 97.81
KOG0320|consensus187 97.75
KOG3039|consensus303 97.72
PF04641260 Rtf2: Rtf2 RING-finger 97.58
KOG2042|consensus943 97.55
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 97.43
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.3
KOG0317|consensus293 97.15
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.14
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.97
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.61
KOG2164|consensus 513 96.56
PF06416113 DUF1076: Protein of unknown function (DUF1076); In 96.56
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.32
PHA02929238 N1R/p28-like protein; Provisional 96.32
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.32
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.23
KOG0396|consensus389 96.2
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.13
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.96
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 94.92
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 94.89
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 94.86
KOG0287|consensus 442 94.64
KOG0978|consensus698 94.43
KOG3113|consensus293 93.23
KOG0297|consensus 391 93.01
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 93.0
KOG4628|consensus348 92.88
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 92.61
KOG1645|consensus 463 91.88
KOG1002|consensus791 90.73
PF07795 214 DUF1635: Protein of unknown function (DUF1635); In 90.72
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 89.66
KOG2177|consensus 386 89.25
KOG1813|consensus313 88.82
KOG2629|consensus300 85.45
COG5222427 Uncharacterized conserved protein, contains RING Z 84.82
KOG2660|consensus 331 84.82
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.43
KOG2879|consensus298 82.39
>KOG0289|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.7e-63  Score=449.72  Aligned_cols=147  Identities=69%  Similarity=1.041  Sum_probs=142.5

Q ss_pred             ccccCCCCCCCCceecCCCCeeeehHHHHHHHHhcCCCCCCCCCCCccCccccCCCCCCCCCCCCCCChhHHHHHhHHHH
Q psy12460          6 TKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSPVTKPKPPQATSIPAILKMLQDEW   85 (171)
Q Consensus         6 ~~CaISge~~~~PVvSp~SG~VFEr~lIekyI~~~G~dPITgepLt~~DLIplk~~~~~~pr~~~~tSIP~lL~~lQnEW   85 (171)
                      |+|+|||++|++||+||+||+|||||+||+||+++|+|||||+||+.+|||+||....++|+||++||||+||++|||||
T Consensus         1 m~CaISgEvP~~PVvS~~Sg~vfEkrLIEqyI~e~G~DPIt~~pLs~eelV~Ik~~~~v~pk~~satSIPalL~~lQdEW   80 (506)
T KOG0289|consen    1 MVCAISGEVPEEPVVSPVSGHVFEKRLIEQYIAETGKDPITNEPLSIEELVEIKVPAQVRPKPPSATSIPALLKTLQDEW   80 (506)
T ss_pred             CeecccCCCCCCccccccccchHHHHHHHHHHHHcCCCCCCCCcCCHHHeeeccccccccCCCCCccchHHHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHhhhhHHHHHHHHhhCcccCCCCCCCCCCc
Q psy12460         86 DAIMLHSFTQRQQLQTARQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGIATPTTIPQP  152 (171)
Q Consensus        86 Da~mLE~f~LRkql~~~rqeLS~aLYq~DAA~RViarl~kErd~ar~~L~~l~~~~~~~~~~~~~~~  152 (171)
                      |++|||+|+|||||+++|||||||||||||||||||||.|||||||++|+++++++|+..+.++|.+
T Consensus        81 DavML~~F~LRqqL~ttrQELShaLYqhDAAcrViaRL~kE~~eareaLa~~~~qa~a~~peav~~~  147 (506)
T KOG0289|consen   81 DAVMLESFTLRQQLQTTRQELSHALYQHDAACRVIARLTKERDEAREALAKLSPQAGAIVPEAVPSL  147 (506)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhhcCcccccccccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999876555553

>PF08606 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This region is found specifically in PRP19-like protein Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG2979|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2042|consensus Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0396|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF07795 DUF1635: Protein of unknown function (DUF1635); InterPro: IPR012862 The members of this family include sequences that are parts of hypothetical proteins expressed by plant species Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG2629|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2bay_A61 Crystal Structure Of The Prp19 U-Box Dimer Length = 1e-08
1n87_A56 Solution Structure Of The U-Box Of Prp19 Length = 5 1e-08
>pdb|2BAY|A Chain A, Crystal Structure Of The Prp19 U-Box Dimer Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 38/49 (77%)
Query: 10 MSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDI 58
          +S +VP  PV+SP S ++FEK L+E+Y+K+ G DPI  E L++E++++I
Sbjct: 8  ISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEI 56
>pdb|1N87|A Chain A, Solution Structure Of The U-Box Of Prp19 Length = 56 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 3e-21
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 2e-06
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 3e-06
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 5e-06
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2f42_A179 STIP1 homology and U-box containing protein 1; cha 4e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-04
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
 Score = 81.2 bits (201), Expect = 3e-21
 Identities = 24/52 (46%), Positives = 38/52 (73%)

Query: 11 SNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSP 62
          S +VP  PV+SP S ++FEK L+E+Y+K+ G DPI  E L++E++++I  S 
Sbjct: 9  SGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSA 60
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.88
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.62
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.58
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.55
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.54
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.41
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.21
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.19
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.12
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.61
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.52
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.5
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.47
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.45
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.45
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.43
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.39
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.38
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.37
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.34
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.32
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.32
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.31
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.3
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.21
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.2
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.19
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.19
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.18
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.15
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.13
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.09
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.02
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.93
2ect_A78 Ring finger protein 126; metal binding protein, st 97.9
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.9
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.88
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.76
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.75
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.68
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.64
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.63
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.6
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.44
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.43
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.4
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.39
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.37
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.37
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.27
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.26
2kkx_A102 Uncharacterized protein ECS2156; methods developme 96.89
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.63
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.58
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.55
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.53
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 96.5
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.38
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 96.24
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 96.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.91
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.4
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.36
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.15
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 94.84
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 94.51
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 92.7
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 92.19
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 88.67
2ea5_A68 Cell growth regulator with ring finger domain prot 88.06
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 81.18
3cve_A72 Homer protein homolog 1; coiled coil, alternative 80.67
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
Probab=99.88  E-value=4.7e-23  Score=140.37  Aligned_cols=59  Identities=41%  Similarity=0.743  Sum_probs=54.2

Q ss_pred             ccccccCCCCCCCCceecCCCCeeeehHHHHHHHHhcCCCCCCCCCCCccCccccCCCC
Q psy12460          4 FGTKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKVSP   62 (171)
Q Consensus         4 ~s~~CaISge~~~~PVvSp~SG~VFEr~lIekyI~~~G~dPITgepLt~~DLIplk~~~   62 (171)
                      |+|+|+||+++|+|||+++.||++|||+.|++||+++|+||+||++|+.+|||++++.+
T Consensus         2 ~~~~CpIs~~~m~dPV~~~~sG~~yer~~I~~~l~~~~~cP~t~~~L~~~~Lip~~~~~   60 (61)
T 2bay_A            2 SHMLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSA   60 (61)
T ss_dssp             --CCCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCCC-
T ss_pred             CeEEecCCCCCCCCCEEeCCCCcEEcHHHHHHHHHhCCCCcCCcCCCChhhcEECccCC
Confidence            68999999999999999966899999999999999999999999999999999999864
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.79
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.58
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.42
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.37
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.68
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.49
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.4
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.95
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.44
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.96
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.81
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.61
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 94.89
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 93.97
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.22
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 83.44
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.79  E-value=3.5e-20  Score=122.28  Aligned_cols=55  Identities=42%  Similarity=0.808  Sum_probs=53.1

Q ss_pred             ccccCCCCCCCCceecCCCCeeeehHHHHHHHHhcCCCCCCCCCCCccCccccCC
Q psy12460          6 TKTVMSNEVPEHPVVSPISGSVFEKRLIEKYIKENGTDPINAERLTLEQLIDIKV   60 (171)
Q Consensus         6 ~~CaISge~~~~PVvSp~SG~VFEr~lIekyI~~~G~dPITgepLt~~DLIplk~   60 (171)
                      |+|+|+++++++||+++++||+|||+.|++|++++++||++|++|+.+|||+++-
T Consensus         1 l~C~Ic~~~~~~Pv~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipik~   55 (56)
T d2baya1           1 MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVP   55 (56)
T ss_dssp             CCCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCC
T ss_pred             CCCccCCchHHhcCccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeCCC
Confidence            6899999999999999989999999999999999999999999999999999974
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure