Diaphorina citri psyllid: psy12466

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680

MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKPGTSSLQSSPRLNASDNVQSSTVNAQTSSVNAQTSSVSASSSLPWRPVKKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLLKPPSGNSPGNDSGIPSLPRKSDSGIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQPDMMEEEGQ

cccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEECccccccccccccccEEEEEccEEEEEccccccccccccccccccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHcccccEEEEECccccHHHHccccccccEEEEHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHcccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHccccccEEEECcccHHHHHHcccccccEEEEEHHHHHHHHHHHccccccEEEEcccccccccccHHHHHHHccccccEEEEccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccEEEEEEEcccHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHcccccccccccccccccc

*******NVLDILNEAYL*************************************SVTRIFNVVYGKPSA*KHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILD**************************************************************EVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDE***************************************************************************************SGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPIL****************LRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQP********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA repair and recombination protein RAD54B	Involved in DNA repair and mitotic recombination.	confident	Q9DG67
DNA repair and recombination protein RAD54B	Involved in DNA repair and mitotic recombination. May play an active role in recombination processes in concert with other members of the RAD52 epistasis group.	confident	Q9Y620

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016514 [CC]	SWI/SNF complex	probable	GO:0043234, GO:0005575, GO:0070603, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0032991, GO:0090544, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016568 [BP]	chromatin modification	probable	GO:0006996, GO:0051276, GO:0006325, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0071103 [BP]	DNA conformation change	probable	GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005856 [CC]	cytoskeleton	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0015616 [MF]	DNA translocase activity	probable	GO:0008094, GO:0016818, GO:0042623, GO:0016787, GO:0017111, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0016887
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z3I, chain X
Confidence level:very confident
Coverage over the Query: 363-671
View the alignment between query and template
View the model in PyMOL

Template: 1Z3I, chain X
Confidence level:very confident
Coverage over the Query: 191-299
View the alignment between query and template
View the model in PyMOL