Psyllid ID: psy12466


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680
MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKPGTSSLQSSPRLNASDNVQSSTVNAQTSSVNAQTSSVSASSSLPWRPVKKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLLKPPSGNSPGNDSGIPSLPRKSDSGIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQPDMMEEEGQ
cccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccEEEEEccEEEEEccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHcccccEEEEEEccccHHHHccccccccEEEEHHHHHHHHHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHcccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHccccccEEEEEcccHHHHHHcccccccEEEEEHHHHHHHHHHHccccccEEEEcccccccccccHHHHHHHccccccEEEEccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccEEEEEEEcccHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHcccccccccccccccccc
cccccHHHHHHHHHHHHHcHHHHHcccccccccccccccccccEEEHcccccccccEEEEEEEEEcccccccccccccccEEEEcHHHHHHHHHcccEEcccEEEHcccccccccccccccccccccccccEEccccccEccccccEEcccccccccccccEEEEEcccccccccccccccccHHHccccEEEEEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccEEEEEHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHcccccHHccccccccccccHHHHHHHHcccccccccccEcccccHHHHccHHHHHHHHHHHHHHHHHHHHHccccccEEHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcHEEEcccHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccc
MAGKDLTNVLDILNEAYLDQEEQFDStlskenhnyvypepggtevseaqnsnhatsVTRIFNVvygkpsakkhksweqdgvleISGTMAILKDTLGKVIDSKVKIldeikpgtsslqssprlnasdnvqSSTVNAQTssvnaqtssvsassslpwrpvkksrlslhaktevnplilpkpivdhqeknrRSYILRVLIVtpssltsnwnDEFKKWLgltrmcpyhvnqknkaedyvysRVSPVLIISYEMLIRAYQTIVDTEFDLlicdeksllkppsgnspgndsgipslprksdsgigslpckrpleestaetlqcnqiNSHLSVTHALRKIcnhpglvqqpdvmeeegqwkhnpsgkplvdvtVDGFlsrvlkphqrqgVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLlrqgpygmpvIRKVLIvtpssltsnwNDEFKKWLgltrmcpyhvnqknkaedyvysRVSPVLIISYEMLIRAYQTIVDTEFdllicdeghrlkngKSKLYELMTGLNIRKRIllsgtplqndlqeffylndfanpgvlGSLREFRKnfeepilesrspnstEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNskretllvcratplqqsLYLRCVEYWDarasrdshLSVTHALRKIcnhpglvqqpdmmeeegq
MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKpgtsslqssprlnASDNVQSSTVNAQtssvnaqtssvsassslpwrpvKKSRLslhaktevnplilpkpivdhqeknRRSYILRVLivtpssltsnwNDEFKKWLGLTRMCPYHVnqknkaedyvySRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLlkppsgnspgndsgipslprksdsgIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWkhnpsgkplvDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLivtpssltsnwNDEFKKWLGLTRMCPYHVnqknkaedyvySRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEghrlkngksKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFeepilesrspnstEAQKSLGELRSSQLAKRTAGFILRRTSDVQASllnskretllvcratplqqslYLRCVEYWDARASRDSHLSVTHALRKICnhpglvqqpdmmeeegq
MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKPGTSSLQSSPRLNASDNVQSSTVNAqtssvnaqtssvsasssLPWRPVKKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLLKPPSGNSPGNDSGIPSLPRKSDSGIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQPDMMEEEGQ
*******NVLDILNEAYL*************************************SVTRIFNVVYGKPSA*KHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILD**************************************************************EVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDE*********************************************LQCNQINSHLSVTHALRKICNHPGLVQ******************PLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFR**********************************AGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHP**************
*************************************************************NVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGK***********************RLNA************************************************PLIL**************YILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYH****************PVLIISYEMLIRAYQTIVDTEFDLLICDE***************************************************************************************SGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHV***********SRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPIL****************LRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRC***************VTHALRKICNHPGLVQQP********
MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGK*********EQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKPG**********************************************KKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLLKP*********SGIPSLPRKSDSGIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILE********************LAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQPDMMEEEGQ
***KDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQN*NHATSVTRIFNVVYGKPS**KHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIK*****************************************SLPWRPVKKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEK****************************************************************************************KPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSP**TEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQ**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKDLTNVLDILNEAYLDQEEQFDSTLSKENHNYVYPEPGGTEVSEAQNSNHATSVTRIFNVVYGKPSAKKHKSWEQDGVLEISGTMAILKDTLGKVIDSKVKILDEIKPGTSSLQSSPRLNASDNVQSSTVNAQTSSVNAQTSSVSASSSLPWRPVKKSRLSLHAKTEVNPLILPKPIVDHQEKNRRSYILRVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEKSLLKPPSGNSPGNDSGIPSLPRKSDSGIGSLPCKRPLEESTAETLQCNQINSHLSVTHALRKICNHPGLVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARASRDSHLSVTHALRKICNHPGLVQQPDMMEEEGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query680 2.2.26 [Sep-21-2011]
Q9Y620 910 DNA repair and recombinat yes N/A 0.469 0.350 0.512 2e-87
Q6PFE3 886 DNA repair and recombinat yes N/A 0.475 0.364 0.493 5e-85
Q9DG67 918 DNA repair and recombinat yes N/A 0.469 0.347 0.503 1e-84
P41410 852 DNA repair protein rhp54 yes N/A 0.463 0.369 0.425 3e-70
P70270 747 DNA repair and recombinat no N/A 0.466 0.424 0.440 1e-68
O12944 733 DNA repair and recombinat no N/A 0.454 0.421 0.447 2e-68
Q92698 747 DNA repair and recombinat no N/A 0.463 0.421 0.443 3e-68
B3MMA5 791 DNA repair and recombinat N/A N/A 0.502 0.432 0.399 8e-67
P32863 898 DNA repair and recombinat yes N/A 0.452 0.342 0.393 3e-64
B4KHL5 783 DNA repair and recombinat N/A N/A 0.502 0.436 0.390 1e-63
>sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 Back     alignment and function desciption
 Score =  324 bits (830), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/326 (51%), Positives = 215/326 (65%), Gaps = 7/326 (2%)

Query: 351 QWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGK 410
           QW  N +  PLVDV +D +L   L+PHQ++G+ FLYE V  +      GAILADEMGLGK
Sbjct: 273 QWVFNKNCFPLVDVVIDPYLVYHLRPHQKEGIIFLYECVMGMRMNGRCGAILADEMGLGK 332

Query: 411 TLQCIALIWTLLRQGPYG-MPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKN 469
           TLQCI+LIWTL  QGPYG  PVI+K LIVTP SL +NW  EF+KWLG  R+  + V+Q +
Sbjct: 333 TLQCISLIWTLQCQGPYGGKPVIKKTLIVTPGSLVNNWKKEFQKWLGSERIKIFTVDQDH 392

Query: 470 KAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNI 529
           K E+++ S    VLIISYEML+R+   I + +FDLLICDEGHRLKN   K    +  L+ 
Sbjct: 393 KVEEFIKSIFYSVLIISYEMLLRSLDQIKNIKFDLLICDEGHRLKNSAIKTTTALISLSC 452

Query: 530 RKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLG 589
            KRI+L+GTP+QNDLQEFF L DF NPG+LGSL  +RK +EEPI+ SR P+++E +K LG
Sbjct: 453 EKRIILTGTPIQNDLQEFFALIDFVNPGILGSLSSYRKIYEEPIILSREPSASEEEKELG 512

Query: 590 ELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARAS- 648
           E R+++L   T  FILRRT ++    L  K E ++ CR   LQ  LY + +     R   
Sbjct: 513 ERRAAELTCLTGLFILRRTQEIINKYLPPKIENVVFCRPGALQIELYRKLLNSQVVRFCL 572

Query: 649 -----RDSHLSVTHALRKICNHPGLV 669
                   HL    AL+K+CNHP L+
Sbjct: 573 QGLLENSPHLICIGALKKLCNHPCLL 598




Involved in DNA repair and mitotic recombination. May play an active role in recombination processes in concert with other members of the RAD52 epistasis group.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 Back     alignment and function description
>sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 Back     alignment and function description
>sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 Back     alignment and function description
>sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 Back     alignment and function description
>sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 Back     alignment and function description
>sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 Back     alignment and function description
>sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 Back     alignment and function description
>sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 Back     alignment and function description
>sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
383847118 856 PREDICTED: DNA repair and recombination 0.544 0.432 0.467 2e-91
241602475680 DNA repair and recombination protein RAD 0.469 0.469 0.508 4e-90
260802348 791 hypothetical protein BRAFLDRAFT_202887 [ 0.539 0.463 0.472 2e-89
189230031 897 RAD54 homolog B [Xenopus (Silurana) trop 0.469 0.355 0.512 5e-89
148230804 895 RAD54 homolog B [Xenopus laevis] gi|4793 0.469 0.356 0.524 7e-89
328786654 821 PREDICTED: DNA repair and recombination 0.45 0.372 0.519 1e-88
395512148 912 PREDICTED: DNA repair and recombination 0.464 0.346 0.516 3e-88
321476094 1001 RAD54B meiotic recombination protein [Da 0.483 0.328 0.469 4e-88
345327482 1623 PREDICTED: hypothetical protein LOC10007 0.469 0.196 0.506 2e-87
380027284717 PREDICTED: DNA repair and recombination 0.45 0.426 0.516 5e-87
>gi|383847118|ref|XP_003699202.1| PREDICTED: DNA repair and recombination protein RAD54B-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 180/385 (46%), Positives = 243/385 (63%), Gaps = 15/385 (3%)

Query: 289 SLPRKSDSGIGSLPCKRPLEESTAE-TLQCNQINSHLSVTHALRKICNHPGLVQQPDVME 347
           SLP +S       P K+ L+ S  +  +  N +   L +TH       +P L+  P  M 
Sbjct: 204 SLPDESSKETIPEPPKKKLKSSNVKPFVPFNSLQQGLKLTH-------NP-LIMPP--MY 253

Query: 348 EEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMG 407
               W  N   K   +V+VD  L  VL+ HQR G+ FLYE +  + + +  GAILADEMG
Sbjct: 254 TSQNWAENEISKDEKEVSVDACLVNVLRQHQRYGIIFLYECIMGIKTSNYYGAILADEMG 313

Query: 408 LGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQ 467
           LGKTLQCI L+WTLL++GPYG PV++ VLIVTPSSL +NWN EFK WLG  R+CPY VN 
Sbjct: 314 LGKTLQCITLVWTLLKKGPYGSPVLKTVLIVTPSSLCNNWNKEFKHWLGFHRLCPYVVNA 373

Query: 468 KNKAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGL 527
           KNK +D+     + V+IISY+MLIR  + I    FDL+ICDEGHRLKN + K  +L++ +
Sbjct: 374 KNKLKDFKKQARNSVVIISYDMLIRCEEEIEQINFDLIICDEGHRLKNNEIKAAKLLSNI 433

Query: 528 NIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKS 587
           N ++RILL+GTP+QNDLQEFF L +F NPG+LGS  EF+  +E PI+ S+ P++  +  S
Sbjct: 434 NCKRRILLTGTPIQNDLQEFFALVNFVNPGILGSNNEFKNYYENPIVASKCPHAAYSVAS 493

Query: 588 LGELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARA 647
           LG  R+++L ++T  FILRRT D     L SK E ++ CR +  Q+ LY    + W  ++
Sbjct: 494 LGTERATELHEKTRSFILRRTQDTINKYLPSKHELVVFCRLSDEQEKLYSLVTDTWFNKS 553

Query: 648 ----SRDSHLSVTHALRKICNHPGL 668
               S   HL+V   L+KICNHP L
Sbjct: 554 VLPNSNVPHLTVITTLKKICNHPKL 578




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|241602475|ref|XP_002405194.1| DNA repair and recombination protein RAD54B, putative [Ixodes scapularis] gi|215500578|gb|EEC10072.1| DNA repair and recombination protein RAD54B, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|260802348|ref|XP_002596054.1| hypothetical protein BRAFLDRAFT_202887 [Branchiostoma floridae] gi|229281308|gb|EEN52066.1| hypothetical protein BRAFLDRAFT_202887 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|189230031|ref|NP_001121509.1| RAD54 homolog B [Xenopus (Silurana) tropicalis] gi|183986491|gb|AAI66345.1| rad54b protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|148230804|ref|NP_001085120.1| RAD54 homolog B [Xenopus laevis] gi|47939775|gb|AAH72215.1| MGC81308 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|328786654|ref|XP_624551.3| PREDICTED: DNA repair and recombination protein RAD54B-like [Apis mellifera] Back     alignment and taxonomy information
>gi|395512148|ref|XP_003760306.1| PREDICTED: DNA repair and recombination protein RAD54B [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|321476094|gb|EFX87055.1| RAD54B meiotic recombination protein [Daphnia pulex] Back     alignment and taxonomy information
>gi|345327482|ref|XP_001506039.2| PREDICTED: hypothetical protein LOC100074424 [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|380027284|ref|XP_003697358.1| PREDICTED: DNA repair and recombination protein RAD54B-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query680
UNIPROTKB|F1P5M3 920 RAD54B "DNA repair and recombi 0.469 0.346 0.503 7e-95
UNIPROTKB|Q9DG67 918 RAD54B "DNA repair and recombi 0.469 0.347 0.503 7e-95
UNIPROTKB|Q9Y620 910 RAD54B "DNA repair and recombi 0.475 0.354 0.506 3.8e-94
UNIPROTKB|F1MSA4 909 RAD54B "Uncharacterized protei 0.475 0.355 0.5 1.5e-91
UNIPROTKB|F1PW14 912 RAD54B "Uncharacterized protei 0.482 0.359 0.494 1.7e-90
ZFIN|ZDB-GENE-060810-50 917 rad54b "RAD54 homolog B (S. ce 0.563 0.417 0.429 1.9e-89
UNIPROTKB|F1RY50 805 RAD54B "Uncharacterized protei 0.469 0.396 0.512 4.4e-88
ASPGD|ASPL0000055935 1011 AN0855 [Emericella nidulans (t 0.598 0.402 0.395 1.6e-74
POMBASE|SPAC15A10.03c 852 rad54 "DNA-dependent ATPase Ra 0.563 0.449 0.391 6.5e-67
MGI|MGI:894697 747 Rad54l "RAD54 like (S. cerevis 0.516 0.469 0.427 1.1e-66
UNIPROTKB|F1P5M3 RAD54B "DNA repair and recombination protein RAD54B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 818 (293.0 bits), Expect = 7.0e-95, Sum P(3) = 7.0e-95
 Identities = 164/326 (50%), Positives = 220/326 (67%)

Query:   351 QWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGK 410
             Q   N +G P+VDV VD +++  L+PHQR+G+ FLYE V  +      GAILADEMGLGK
Sbjct:   280 QCMFNKAGLPVVDVVVDPYIANNLRPHQREGIVFLYECVMGMRVSGRFGAILADEMGLGK 339

Query:   411 TLQCIALIWTLLRQGPYGM-PVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKN 469
             TLQCI+L+WTLLRQG YG  PV+++ LIVTP SL  NW  EF+KWLG  R+  + V+Q +
Sbjct:   340 TLQCISLVWTLLRQGVYGCKPVLKRALIVTPGSLVKNWKKEFQKWLGSERIKVFTVDQDH 399

Query:   470 KAEDYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNI 529
             K E+++ S +  V+IISYEML+R+   I   EF+LLICDEGHRLKN   K    +T L+ 
Sbjct:   400 KVEEFISSPLYSVMIISYEMLLRSLDQIQAIEFNLLICDEGHRLKNSSIKTTTALTNLSC 459

Query:   530 RKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLG 589
              +RI+L+GTP+QNDLQEF+ L +F NPGVLGSL  +RK +EEPI+ SR P++T+ +K LG
Sbjct:   460 ERRIILTGTPIQNDLQEFYALIEFVNPGVLGSLSTYRKIYEEPIVRSREPSATKEEKDLG 519

Query:   590 ELRSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEY------W 643
             E R+++L + T  FILRRT +V    L  K+E ++ C+ T LQ  LY + +         
Sbjct:   520 EKRAAELTRLTGLFILRRTQEVINKFLPPKKENIIFCQPTALQLELYQKLLSSRVISSCL 579

Query:   644 DARASRDSHLSVTHALRKICNHPGLV 669
               R     HL    AL+K+CNHP L+
Sbjct:   580 QGRLENSPHLICIGALKKLCNHPCLL 605


GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0000724 "double-strand break repair via homologous recombination" evidence=IEA
GO:0015616 "DNA translocase activity" evidence=IEA
UNIPROTKB|Q9DG67 RAD54B "DNA repair and recombination protein RAD54B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y620 RAD54B "DNA repair and recombination protein RAD54B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSA4 RAD54B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PW14 RAD54B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-50 rad54b "RAD54 homolog B (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RY50 RAD54B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ASPGD|ASPL0000055935 AN0855 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC15A10.03c rad54 "DNA-dependent ATPase Rad54/Rhp54" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
MGI|MGI:894697 Rad54l "RAD54 like (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y620RA54B_HUMAN3, ., 6, ., 4, ., -0.51220.46910.3505yesN/A
Q9DG67RA54B_CHICK3, ., 6, ., 4, ., -0.50300.46910.3474yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 3e-77
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 3e-48
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 5e-35
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 9e-27
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-21
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-11
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-08
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-07
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 4e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-05
COG4096 875 COG4096, HsdR, Type I site-specific restriction-mo 0.001
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 0.002
PRK04914 956 PRK04914, PRK04914, ATP-dependent helicase HepA; V 0.004
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
 Score =  248 bits (636), Expect = 3e-77
 Identities = 109/313 (34%), Positives = 161/313 (51%), Gaps = 32/313 (10%)

Query: 377 HQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVL 436
           +Q +GV++L     +       G ILADEMGLGKTLQ IAL+ T L++G          L
Sbjct: 1   YQLEGVNWLISLESNGL-----GGILADEMGLGKTLQTIALLATYLKEGKD---RRGPTL 52

Query: 437 IVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAED----YVYSRVSPVLIISYEMLIR 492
           +V P S   NW +EF+KW    R+  YH + + +++             V+I +YE+L +
Sbjct: 53  VVCPLSTLHNWLNEFEKWAPALRVVVYHGDGRERSKLRQSMAKRLDTYDVVITTYEVLRK 112

Query: 493 AYQTIVDT----EFDLLICDEGHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFF 548
             + ++      E+D ++ DE HRLKN KSKLY+ +  L  R R+LL+GTP+QN+L+E +
Sbjct: 113 -DKKLLSLLNKVEWDRVVLDEAHRLKNSKSKLYKALKKLKTRNRLLLTGTPIQNNLEELW 171

Query: 549 YLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRRT 608
            L +F  PG  GS + F + F  PI    + ++       G+   ++L K    F+LRRT
Sbjct: 172 ALLNFLRPGPFGSFKVFEEWFNIPIA--NTADNKNKNLEKGKEGINRLHKLLKPFLLRRT 229

Query: 609 -SDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDA---RASRDSHLSVTHA------ 658
             DV+ SL   K E +L C  +  Q+ LY + +         A      +V  A      
Sbjct: 230 KDDVEKSLPP-KTEHVLYCNLSDEQRKLYKKLLTKRRLALSFAVEGGEKNVGIASLLNLI 288

Query: 659 --LRKICNHPGLV 669
             LRKICNHP L 
Sbjct: 289 MQLRKICNHPYLF 301


This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301

>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|226581 COG4096, HsdR, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|235319 PRK04914, PRK04914, ATP-dependent helicase HepA; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 680
KOG0387|consensus 923 100.0
KOG0385|consensus 971 100.0
KOG0391|consensus 1958 100.0
KOG0392|consensus 1549 100.0
KOG0388|consensus 1185 100.0
KOG0389|consensus 941 100.0
KOG0384|consensus 1373 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0390|consensus 776 100.0
KOG0386|consensus 1157 100.0
KOG1015|consensus 1567 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
KOG4439|consensus 901 100.0
KOG1016|consensus 1387 100.0
KOG1002|consensus 791 100.0
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1000|consensus 689 100.0
KOG0383|consensus696 99.98
PRK04914 956 ATP-dependent helicase HepA; Validated 99.97
KOG1001|consensus 674 99.96
KOG0298|consensus 1394 99.91
KOG0387|consensus 923 99.88
KOG0390|consensus776 99.86
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.85
KOG0385|consensus 971 99.81
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.76
KOG0392|consensus1549 99.75
KOG1002|consensus791 99.74
KOG0389|consensus941 99.73
KOG1016|consensus 1387 99.73
KOG1015|consensus 1567 99.73
KOG4439|consensus901 99.73
KOG0391|consensus 1958 99.72
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.7
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.69
PRK13766 773 Hef nuclease; Provisional 99.59
KOG0388|consensus1185 99.57
KOG0386|consensus 1157 99.56
PHA02558 501 uvsW UvsW helicase; Provisional 99.56
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.55
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.54
smart00487201 DEXDc DEAD-like helicases superfamily. 99.54
KOG0384|consensus 1373 99.53
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.5
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.44
KOG1123|consensus 776 99.44
KOG1000|consensus689 99.41
PRK04914 956 ATP-dependent helicase HepA; Validated 99.4
COG4096 875 HsdR Type I site-specific restriction-modification 99.39
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.37
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.27
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.26
KOG1001|consensus674 99.25
KOG0354|consensus 746 99.22
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.2
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.2
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.16
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.11
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.11
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.07
COG4889 1518 Predicted helicase [General function prediction on 99.06
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.04
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.03
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.0
PRK10689 1147 transcription-repair coupling factor; Provisional 98.99
PRK02362 737 ski2-like helicase; Provisional 98.98
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.98
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.97
PRK00254 720 ski2-like helicase; Provisional 98.97
PTZ00424401 helicase 45; Provisional 98.95
PTZ00110545 helicase; Provisional 98.95
PRK01172 674 ski2-like helicase; Provisional 98.94
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.93
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.92
PRK13767 876 ATP-dependent helicase; Provisional 98.92
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.91
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.91
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.9
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.89
KOG0298|consensus 1394 98.89
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.85
PRK09401 1176 reverse gyrase; Reviewed 98.83
COG1204 766 Superfamily II helicase [General function predicti 98.81
PRK05580 679 primosome assembly protein PriA; Validated 98.77
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.77
COG1205 851 Distinct helicase family with a unique C-terminal 98.74
COG0610 962 Type I site-specific restriction-modification syst 98.73
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.71
KOG0383|consensus696 98.68
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.56
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.55
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.55
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.53
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.49
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.48
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.47
PRK15483 986 type III restriction-modification system StyLTI en 98.44
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.41
KOG0331|consensus519 98.37
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.34
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.27
PRK14701 1638 reverse gyrase; Provisional 98.24
PRK09694 878 helicase Cas3; Provisional 98.23
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.22
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.21
PHA02653 675 RNA helicase NPH-II; Provisional 98.17
KOG0350|consensus 620 98.14
KOG0952|consensus 1230 98.14
KOG1123|consensus776 98.08
KOG0330|consensus476 98.07
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.06
smart00487201 DEXDc DEAD-like helicases superfamily. 98.04
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.01
COG1202 830 Superfamily II helicase, archaea-specific [General 97.98
KOG0338|consensus 691 97.97
PHA02558501 uvsW UvsW helicase; Provisional 97.96
KOG1513|consensus 1300 97.95
PRK13766 773 Hef nuclease; Provisional 97.93
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.89
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.77
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.66
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.64
PRK09200 790 preprotein translocase subunit SecA; Reviewed 97.63
KOG0335|consensus482 97.59
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.57
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 97.51
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.5
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.5
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.48
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.48
KOG0947|consensus 1248 97.46
KOG0342|consensus 543 97.45
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.43
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 97.41
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.41
KOG0345|consensus 567 97.38
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.37
KOG0353|consensus 695 97.31
KOG0348|consensus 708 97.31
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.31
KOG0343|consensus 758 97.27
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.26
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.25
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.24
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.24
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.23
PRK10536262 hypothetical protein; Provisional 97.21
KOG0339|consensus 731 97.21
KOG0951|consensus 1674 97.14
KOG0328|consensus400 97.11
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.1
PRK14873 665 primosome assembly protein PriA; Provisional 97.07
KOG1803|consensus 649 97.03
PF1038283 DUF2439: Protein of unknown function (DUF2439); In 97.02
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.96
PRK106891147 transcription-repair coupling factor; Provisional 96.94
KOG0948|consensus 1041 96.92
KOG0347|consensus 731 96.92
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 96.9
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 96.89
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.88
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.7
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 96.6
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 96.55
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.54
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 96.51
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 96.47
PRK04296190 thymidine kinase; Provisional 96.44
KOG0346|consensus 569 96.4
PRK12904 830 preprotein translocase subunit SecA; Reviewed 96.4
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 96.4
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.39
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 96.37
KOG1802|consensus 935 96.33
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.27
PRK13107 908 preprotein translocase subunit SecA; Reviewed 96.25
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.25
PRK12326 764 preprotein translocase subunit SecA; Reviewed 96.21
COG1205 851 Distinct helicase family with a unique C-terminal 96.2
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.19
KOG0340|consensus 442 96.14
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.14
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.09
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 95.94
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.92
PRK09401 1176 reverse gyrase; Reviewed 95.88
KOG0351|consensus 941 95.86
PTZ00110545 helicase; Provisional 95.84
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.82
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 95.76
PRK02362 737 ski2-like helicase; Provisional 95.75
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.7
smart00382148 AAA ATPases associated with a variety of cellular 95.69
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 95.52
KOG0334|consensus 997 95.51
KOG0336|consensus629 95.49
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.46
KOG0352|consensus 641 95.39
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.36
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 95.35
KOG0333|consensus673 95.3
PRK10875 615 recD exonuclease V subunit alpha; Provisional 95.25
KOG1805|consensus 1100 95.24
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 95.2
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 95.2
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.16
PRK01172 674 ski2-like helicase; Provisional 95.09
PRK00254 720 ski2-like helicase; Provisional 95.08
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.05
KOG0949|consensus 1330 94.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 94.96
KOG4284|consensus 980 94.92
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.91
PLN03025319 replication factor C subunit; Provisional 94.88
KOG0950|consensus 1008 94.85
KOG0341|consensus 610 94.84
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.78
PTZ00424401 helicase 45; Provisional 94.75
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 94.75
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.69
KOG1132|consensus 945 94.59
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.56
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 94.53
TIGR00595505 priA primosomal protein N'. All proteins in this f 94.42
COG1204 766 Superfamily II helicase [General function predicti 94.41
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.32
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 94.3
PRK08116268 hypothetical protein; Validated 94.28
KOG0925|consensus 699 94.27
COG4889 1518 Predicted helicase [General function prediction on 94.23
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.18
KOG0922|consensus 674 94.16
KOG0329|consensus387 94.12
KOG0926|consensus 1172 94.11
PRK14974336 cell division protein FtsY; Provisional 94.1
PRK08084235 DNA replication initiation factor; Provisional 94.09
KOG0344|consensus 593 94.08
PRK13767 876 ATP-dependent helicase; Provisional 94.07
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.05
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 93.93
CHL00122 870 secA preprotein translocase subunit SecA; Validate 93.83
COG4096 875 HsdR Type I site-specific restriction-modification 93.81
PRK07952244 DNA replication protein DnaC; Validated 93.8
PF11496 297 HDA2-3: Class II histone deacetylase complex subun 93.79
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.7
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.65
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 93.61
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 93.57
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 93.55
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 93.5
PRK06526254 transposase; Provisional 93.46
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 93.41
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.38
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.21
KOG1131|consensus 755 93.19
KOG0337|consensus 529 93.17
KOG0924|consensus 1042 92.98
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 92.95
PRK14701 1638 reverse gyrase; Provisional 92.94
KOG0326|consensus459 92.93
PRK05580679 primosome assembly protein PriA; Validated 92.91
KOG0989|consensus346 92.89
PHA02533 534 17 large terminase protein; Provisional 92.85
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.83
PRK05642234 DNA replication initiation factor; Validated 92.81
CHL00181287 cbbX CbbX; Provisional 92.79
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 92.78
PRK06835329 DNA replication protein DnaC; Validated 92.75
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 92.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.63
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.59
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 92.48
PRK09112351 DNA polymerase III subunit delta'; Validated 92.45
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 92.44
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 92.4
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 92.38
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 92.37
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 92.35
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 92.23
KOG0991|consensus333 92.2
KOG0920|consensus 924 92.16
PRK00149450 dnaA chromosomal replication initiation protein; R 92.15
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.08
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.0
KOG0350|consensus620 91.8
PRK08181269 transposase; Validated 91.78
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 91.74
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 91.73
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 91.64
TIGR00362405 DnaA chromosomal replication initiator protein Dna 91.52
PRK05707328 DNA polymerase III subunit delta'; Validated 91.43
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.41
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.3
PRK08727233 hypothetical protein; Validated 91.22
KOG0780|consensus 483 91.22
KOG0734|consensus 752 91.21
PRK11823 446 DNA repair protein RadA; Provisional 91.15
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 91.15
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 91.13
PHA02544316 44 clamp loader, small subunit; Provisional 91.09
cd03115173 SRP The signal recognition particle (SRP) mediates 91.09
PRK14087450 dnaA chromosomal replication initiation protein; P 91.08
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 91.02
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 91.01
PF1324576 AAA_19: Part of AAA domain 90.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.94
PRK06893229 DNA replication initiation factor; Validated 90.88
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 90.85
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 90.82
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 90.73
COG2256 436 MGS1 ATPase related to the helicase subunit of the 90.59
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.57
PRK00771437 signal recognition particle protein Srp54; Provisi 90.55
PRK12377248 putative replication protein; Provisional 90.51
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 90.34
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 90.3
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.24
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 90.17
PTZ001121164 origin recognition complex 1 protein; Provisional 90.16
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 90.07
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 90.04
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 90.02
PF00004132 AAA: ATPase family associated with various cellula 89.94
PRK13889 988 conjugal transfer relaxase TraA; Provisional 89.92
PRK12422445 chromosomal replication initiation protein; Provis 89.72
KOG0354|consensus 746 89.71
PRK12402337 replication factor C small subunit 2; Reviewed 89.71
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 89.69
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 89.64
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 89.6
CHL00095 821 clpC Clp protease ATP binding subunit 89.5
KOG0332|consensus477 89.47
PRK10865 857 protein disaggregation chaperone; Provisional 89.44
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 89.41
PRK14088440 dnaA chromosomal replication initiation protein; P 89.38
PRK06921266 hypothetical protein; Provisional 89.31
KOG0951|consensus 1674 89.22
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 89.15
KOG0331|consensus519 89.15
PF13173128 AAA_14: AAA domain 89.14
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 89.05
PHA03368 738 DNA packaging terminase subunit 1; Provisional 88.93
PRK00440319 rfc replication factor C small subunit; Reviewed 88.9
PRK08903227 DnaA regulatory inactivator Hda; Validated 88.89
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 88.76
PRK07471365 DNA polymerase III subunit delta'; Validated 88.66
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 88.55
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 88.19
KOG0738|consensus491 88.19
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 88.01
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 87.93
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 87.88
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 87.85
PHA03372 668 DNA packaging terminase subunit 1; Provisional 87.83
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.82
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 87.79
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 87.67
PRK14086617 dnaA chromosomal replication initiation protein; P 87.53
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 87.43
PRK07940394 DNA polymerase III subunit delta'; Validated 87.16
PRK06067234 flagellar accessory protein FlaH; Validated 87.14
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 87.07
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.94
KOG0327|consensus397 86.92
smart00488289 DEXDc2 DEAD-like helicases superfamily. 86.72
smart00489289 DEXDc3 DEAD-like helicases superfamily. 86.72
PTZ00293211 thymidine kinase; Provisional 86.4
PRK13826 1102 Dtr system oriT relaxase; Provisional 86.18
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 86.1
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 86.1
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 86.0
PRK10416318 signal recognition particle-docking protein FtsY; 85.95
COG0470325 HolB ATPase involved in DNA replication [DNA repli 85.84
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 85.61
COG0552340 FtsY Signal recognition particle GTPase [Intracell 85.6
KOG0342|consensus543 85.47
PRK03992389 proteasome-activating nucleotidase; Provisional 85.43
PRK13342413 recombination factor protein RarA; Reviewed 85.42
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 85.33
TIGR00959428 ffh signal recognition particle protein. This mode 85.26
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 85.24
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 85.19
KOG0733|consensus802 85.1
PRK10867433 signal recognition particle protein; Provisional 85.06
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 85.01
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 84.89
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 84.88
PRK08939306 primosomal protein DnaI; Reviewed 84.85
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 84.81
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 84.63
PRK00411394 cdc6 cell division control protein 6; Reviewed 84.61
PRK08769319 DNA polymerase III subunit delta'; Validated 84.23
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 84.17
PRK08058329 DNA polymerase III subunit delta'; Validated 84.15
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 84.1
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 83.97
KOG0923|consensus 902 83.86
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 83.84
PRK05298 652 excinuclease ABC subunit B; Provisional 83.77
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 83.75
TIGR00064272 ftsY signal recognition particle-docking protein F 83.67
KOG0740|consensus428 83.64
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 83.64
PF02702211 KdpD: Osmosensitive K+ channel His kinase sensor d 83.47
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 83.46
KOG0729|consensus435 83.43
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 83.22
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 82.94
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 82.9
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 82.84
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 82.83
KOG0339|consensus731 82.72
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 82.65
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 82.58
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 82.58
PRK08533230 flagellar accessory protein FlaH; Reviewed 82.04
PRK04195 482 replication factor C large subunit; Provisional 81.87
COG1201 814 Lhr Lhr-like helicases [General function predictio 81.81
PRK09183259 transposase/IS protein; Provisional 81.61
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 81.54
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 81.18
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 80.31
PRK11054 684 helD DNA helicase IV; Provisional 80.21
PRK06871325 DNA polymerase III subunit delta'; Validated 80.16
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 80.15
PRK07993334 DNA polymerase III subunit delta'; Validated 80.01
>KOG0387|consensus Back     alignment and domain information
Probab=100.00  E-value=1.7e-60  Score=521.44  Aligned_cols=302  Identities=34%  Similarity=0.535  Sum_probs=276.7

Q ss_pred             ccccCcccccccCcccHHHHHHHHHhhhhhccCCCCceEEEcCCCCChHHHHHHHHHHHHhcCCCCCCccceEEEEeccc
Q psy12466        363 DVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSS  442 (680)
Q Consensus       363 ~~~~p~~l~~~LrpyQ~~gv~~l~~~~~~~~~~~~~g~iLaDemGlGKT~~aiali~~~~~~~~~~~~~~~~~LIV~P~s  442 (680)
                      .+.||..+.+.|+|||++||+||++.     +-.+.||||+||||||||+|+|+|++.+...+..    .+|+|||||.+
T Consensus       195 ~~~vPg~I~~~Lf~yQreGV~WL~~L-----~~q~~GGILgDeMGLGKTIQiisFLaaL~~S~k~----~~paLIVCP~T  265 (923)
T KOG0387|consen  195 GFKVPGFIWSKLFPYQREGVQWLWEL-----YCQRAGGILGDEMGLGKTIQIISFLAALHHSGKL----TKPALIVCPAT  265 (923)
T ss_pred             cccccHHHHHHhhHHHHHHHHHHHHH-----HhccCCCeecccccCccchhHHHHHHHHhhcccc----cCceEEEccHH
Confidence            37899999999999999999999985     4567899999999999999999999999887542    36799999999


Q ss_pred             hHHHHHHHHHHHhCCCCeeEeecCCcchhh-------------hhhhcCCCCEEEEeHHHHHHHHHhhhccCceEEEEcC
Q psy12466        443 LTSNWNDEFKKWLGLTRMCPYHVNQKNKAE-------------DYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDE  509 (680)
Q Consensus       443 ll~qW~~E~~~~~~~~~v~~~~~~~~~~~~-------------~~~~~~~~~vvI~ty~~l~~~~~~l~~~~~~~vIlDE  509 (680)
                      ++.||..||.+|+|..++.++|+.......             .........|+||||+.++..-+.+....|+++|+||
T Consensus       266 ii~qW~~E~~~w~p~~rv~ilh~t~s~~r~~~~~~~~~~~~~L~r~~~~~~~ilitty~~~r~~~d~l~~~~W~y~ILDE  345 (923)
T KOG0387|consen  266 IIHQWMKEFQTWWPPFRVFILHGTGSGARYDASHSSHKKDKLLIRKVATDGGILITTYDGFRIQGDDLLGILWDYVILDE  345 (923)
T ss_pred             HHHHHHHHHHHhCcceEEEEEecCCcccccccchhhhhhhhhheeeecccCcEEEEehhhhcccCcccccccccEEEecC
Confidence            999999999999999999999998773211             1111235679999999999988889999999999999


Q ss_pred             cccccCcccHHHHHHHhcccceEEEEeCCCCCCCHHHHHHHHhhhCCCCCCCHHHHHHHhhhhhhccCCCCChHHHHHhh
Q psy12466        510 GHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLG  589 (680)
Q Consensus       510 aH~~kn~~s~~~~~l~~l~~~~rllLTgTP~~n~~~el~sll~fl~p~~l~~~~~F~~~f~~~i~~~~~~~~~~~~~~~~  589 (680)
                      +|+|||++++.+.++.++++.+|++||||||||++.|||+|++|+.|+.+++...|.+.|..||..|++.+++..+...+
T Consensus       346 GH~IrNpns~islackki~T~~RiILSGTPiQNnL~ELwsLfDFv~PG~Lgt~~~F~~~f~~pI~~GgyaNAs~~qv~~a  425 (923)
T KOG0387|consen  346 GHRIRNPNSKISLACKKIRTVHRIILSGTPIQNNLTELWSLFDFVFPGKLGTLPVFQQNFEHPINRGGYANASPRQVQTA  425 (923)
T ss_pred             cccccCCccHHHHHHHhccccceEEeeCccccchHHHHHHHhhhccCCcccchHHHHhhhhhheeccccCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHhccceeeechhHHhh-cCCCcEEEEEEecCCHHHHHHHHHHHHHHHHHh---chhhHHHHHHHHHHhccC
Q psy12466        590 ELRSSQLAKRTAGFILRRTSDVQAS-LLNSKRETLLVCRATPLQQSLYLRCVEYWDARA---SRDSHLSVTHALRKICNH  665 (680)
Q Consensus       590 ~~~~~~L~~~l~~f~lRrtk~~v~~-~LP~k~e~~v~v~ms~~Q~~lY~~l~~~~~~~~---~~~~~l~~l~~LRqicnH  665 (680)
                      +.+...|+.+++||+|||+|.++.. .||.|.|+|++|.||+.|+++|++++++.....   .....|..+..||++|||
T Consensus       426 ykca~~Lr~lI~PylLRR~K~dv~~~~Lp~K~E~VlfC~LT~~QR~~Y~~fl~s~~v~~i~ng~~~~l~Gi~iLrkICnH  505 (923)
T KOG0387|consen  426 YKCAVALRDLISPYLLRRMKSDVKGLKLPKKEEIVLFCRLTKLQRRLYQRFLNSSEVNKILNGKRNCLSGIDILRKICNH  505 (923)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHhhhccCCCccceEEEEeccHHHHHHHHHHhhhHHHHHHHcCCccceechHHHHhhcCC
Confidence            9999999999999999999999988 999999999999999999999999999877654   455678899999999999


Q ss_pred             ccccCCCC
Q psy12466        666 PGLVQQPD  673 (680)
Q Consensus       666 P~L~~~~~  673 (680)
                      |.|+...+
T Consensus       506 Pdll~~~~  513 (923)
T KOG0387|consen  506 PDLLDRRD  513 (923)
T ss_pred             cccccCcc
Confidence            99999863



>KOG0385|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF10382 DUF2439: Protein of unknown function (DUF2439); InterPro: IPR018838 This domain is found at the N-terminal of proteins implicated in telomere maintenance in Saccharomyces cerevisiae (Baker's yeast) [] and in meiotic chromosome segregation in Schizosaccharomyces pombe (Fission yeast) [] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
1z3i_X 644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 3e-66
1z6a_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 2e-27
1z63_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 5e-26
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 3e-25
3dmq_A 968 Crystal Structure Of Rapa, A Swi2SNF2 PROTEIN THAT 2e-06
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure

Iteration: 1

Score = 249 bits (636), Expect = 3e-66, Method: Compositional matrix adjust. Identities = 140/334 (41%), Positives = 203/334 (60%), Gaps = 17/334 (5%) Query: 362 VDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTL 421 V V VD LS+VL+PHQR+GV FL++ V + G I+ADEMGLGKTLQCI LIWTL Sbjct: 44 VHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCITLIWTL 103 Query: 422 LRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVNQKNKAE------DYV 475 L+Q P P I KV++V+PSSL NW +E KWLG R+ P ++ +K E +++ Sbjct: 104 LKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLG-GRVQPVAIDGGSKDEIDSKLVNFI 162 Query: 476 YSRV----SPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNGKSKLYELMTGLNIRK 531 + +P+LIISYE + + + L+ICDEGHRLKN ++ Y + +N ++ Sbjct: 163 SQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQR 222 Query: 532 RILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGEL 591 R+L+SGTP+QNDL E+F L F N G+LG+ +EF+K FE PIL+ R ++++ ++ GE Sbjct: 223 RVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQ 282 Query: 592 RSSQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLY------LRCVEYWDA 645 + +L ++RRTSD+ + L K E ++ C TPLQ+ LY + VE Sbjct: 283 KLQELISIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQT 342 Query: 646 RASRDSHLSVTHALRKICNHPGLVQQPDMMEEEG 679 S LS +L+K+CNHP L+ + + EEG Sbjct: 343 GKISVSSLSSITSLKKLCNHPALIYEKCLTGEEG 376
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure
>pdb|3DMQ|A Chain A, Crystal Structure Of Rapa, A Swi2SNF2 PROTEIN THAT Recycles Rna Polymerase During Transcription Length = 968 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query680
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 1e-128
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 3e-17
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-56
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-52
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 8e-12
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 3e-52
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 4e-10
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-09
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-08
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 4e-08
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
 Score =  392 bits (1008), Expect = e-128
 Identities = 137/350 (39%), Positives = 196/350 (56%), Gaps = 19/350 (5%)

Query: 347 EEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEM 406
                       K  V V VD  LS+VL+PHQR+GV FL++ V      +  G I+ADEM
Sbjct: 29  ISAHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEM 88

Query: 407 GLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLTRMCPYHVN 466
           GLGKTLQCI LIWTLL+Q P   P I KV++V+PSSL  NW +E  KWLG  R+ P  ++
Sbjct: 89  GLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLG-GRVQPVAID 147

Query: 467 QKNKAE----------DYVYSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRLKNG 516
             +K E                 +P+LIISYE      + +   +  L+ICDEGHRLKN 
Sbjct: 148 GGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNS 207

Query: 517 KSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILES 576
            ++ Y  +  +N ++R+L+SGTP+QNDL E+F L  F N G+LG+ +EF+K FE PIL+ 
Sbjct: 208 DNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKG 267

Query: 577 RSPNSTEAQKSLGELRSSQLAKRTAGFILRRT-SDVQASLLNSKRETLLVCRATPLQQSL 635
           R  ++++  ++ GE +  +L       ++RRT   +   L   K E ++ C  TPLQ+ L
Sbjct: 268 RDADASDKDRAAGEQKLQELISIVNRCLIRRTSDILSKYLP-VKIEQVVCCNLTPLQKEL 326

Query: 636 YLRCVEYWDARA------SRDSHLSVTHALRKICNHPGLVQQPDMMEEEG 679
           Y   ++               S LS   +L+K+CNHP L+ +  +  EEG
Sbjct: 327 YKLFLKQAKPVESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEEG 376


>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 100.0
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.95
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.84
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.78
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.78
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.7
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.7
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.69
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.67
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.67
3h1t_A 590 Type I site-specific restriction-modification syst 99.67
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.67
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.66
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.66
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.66
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.63
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.62
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.61
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.6
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.56
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.56
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.55
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.54
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.53
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.52
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.52
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.51
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.51
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.5
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.49
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.47
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.47
3bor_A237 Human initiation factor 4A-II; translation initiat 99.46
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.45
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.44
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.43
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.42
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.41
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.4
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.4
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.39
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.37
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.33
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.32
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.32
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.31
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.3
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.3
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.29
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.28
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.25
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.24
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.18
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.17
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.17
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.17
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.17
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.15
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.15
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.14
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.11
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.04
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.8
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.77
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.75
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.72
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.59
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.56
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.54
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.53
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.52
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.49
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.47
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.46
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.43
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.43
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.41
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.39
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.38
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.36
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.33
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.31
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.31
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.3
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.28
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.27
3h1t_A590 Type I site-specific restriction-modification syst 98.22
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.2
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.18
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.15
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.14
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.13
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.11
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.09
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.09
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.08
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.06
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.06
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.04
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.04
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.04
3bor_A237 Human initiation factor 4A-II; translation initiat 98.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.92
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.9
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.9
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.89
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.87
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.82
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.71
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.68
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.66
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.58
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.55
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.53
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.5
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 97.49
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.49
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.48
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.47
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.46
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.45
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.36
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.28
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.25
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.23
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.15
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.13
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 97.04
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.99
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 96.99
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.95
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 96.92
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.8
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.79
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.74
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.68
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.65
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.6
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.59
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 96.43
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 96.43
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.38
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.35
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.24
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.21
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.19
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.18
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 96.14
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.02
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.88
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.77
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.74
3jux_A 822 Protein translocase subunit SECA; protein transloc 95.62
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 95.52
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.24
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 94.71
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.6
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.59
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.49
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.33
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.24
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.01
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.86
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.84
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.78
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 93.6
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.5
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.45
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.92
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 92.8
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.73
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 92.32
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 92.25
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.22
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.18
3bos_A242 Putative DNA replication factor; P-loop containing 92.12
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.66
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.65
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 91.64
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 91.48
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 91.43
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 91.35
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 91.32
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 90.88
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 90.86
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 90.75
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 90.66
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 90.54
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 90.34
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.63
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.48
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 89.44
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.4
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.27
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.26
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.79
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 88.21
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 88.0
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 87.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 87.41
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 87.04
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 86.58
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 86.44
2v1u_A387 Cell division control protein 6 homolog; DNA repli 86.44
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 86.21
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.01
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 85.81
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 85.66
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 85.36
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 85.03
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 84.93
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 84.5
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 83.48
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 83.48
3pvs_A 447 Replication-associated recombination protein A; ma 83.28
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 82.93
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 82.63
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 81.94
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 81.6
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 81.4
2kjq_A149 DNAA-related protein; solution structure, NESG, st 81.39
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 80.9
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 80.89
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 80.59
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 80.43
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
Probab=100.00  E-value=1.7e-49  Score=460.25  Aligned_cols=309  Identities=42%  Similarity=0.734  Sum_probs=267.3

Q ss_pred             ccccCcccccccCcccHHHHHHHHHhhhhhccCCCCceEEEcCCCCChHHHHHHHHHHHHhcCCCCCCccceEEEEeccc
Q psy12466        363 DVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSS  442 (680)
Q Consensus       363 ~~~~p~~l~~~LrpyQ~~gv~~l~~~~~~~~~~~~~g~iLaDemGlGKT~~aiali~~~~~~~~~~~~~~~~~LIV~P~s  442 (680)
                      .+.+||.+...|||||++|++||++++.+....++.||||||+||+|||+|+|+++..+...++...|..+++|||||.+
T Consensus        45 ~~~~~p~l~~~LrpyQ~~gv~~l~~~~~~~~~~~~~g~ILad~mGlGKT~~~i~~i~~l~~~~~~~~p~~~~~LiV~P~s  124 (644)
T 1z3i_X           45 HVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSS  124 (644)
T ss_dssp             CEECCHHHHTTCCHHHHHHHHHHHHHHTTSSSTTCCEEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHH
T ss_pred             eEeeChhhhhcccHHHHHHHHHHHHhhhcccccCCCCeEeeeCCCchHHHHHHHHHHHHHHhCccccCCCCcEEEEecHH
Confidence            35678889999999999999999987543323567899999999999999999999999888776666778899999999


Q ss_pred             hHHHHHHHHHHHhCC-CCeeEeecCCcchh-h---hhhhc----CCCCEEEEeHHHHHHHHHhhhccCceEEEEcCcccc
Q psy12466        443 LTSNWNDEFKKWLGL-TRMCPYHVNQKNKA-E---DYVYS----RVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRL  513 (680)
Q Consensus       443 ll~qW~~E~~~~~~~-~~v~~~~~~~~~~~-~---~~~~~----~~~~vvI~ty~~l~~~~~~l~~~~~~~vIlDEaH~~  513 (680)
                      ++.||.+||.+|++. ..+..+++...... .   .+...    ..++|+|+||+++......+....|++||+||||++
T Consensus       125 ll~qW~~E~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~vvi~ty~~l~~~~~~l~~~~~~~vI~DEaH~i  204 (644)
T 1z3i_X          125 LVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRL  204 (644)
T ss_dssp             HHHHHHHHHHHHHGGGCCEEEECSSCHHHHHHHHHHHHCCCSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGC
T ss_pred             HHHHHHHHHHHHcCCCeeEEEEeCCCHHHHHHHHHHHHHhcCCCCCCcEEEeeHHHHHhhHHHhhcCCccEEEEECceec
Confidence            999999999999975 44444444332211 1   11111    247899999999999888888899999999999999


Q ss_pred             cCcccHHHHHHHhcccceEEEEeCCCCCCCHHHHHHHHhhhCCCCCCCHHHHHHHhhhhhhccCCCCChHHHHHhhhhHH
Q psy12466        514 KNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRS  593 (680)
Q Consensus       514 kn~~s~~~~~l~~l~~~~rllLTgTP~~n~~~el~sll~fl~p~~l~~~~~F~~~f~~~i~~~~~~~~~~~~~~~~~~~~  593 (680)
                      ||..++.++++..+++.+||+|||||++|++.|||++++|++|+.+++...|.+.|..|+..+...+.+......+..+.
T Consensus       205 kn~~~~~~~al~~l~~~~rl~LTgTPiqN~l~El~sll~fl~p~~l~~~~~F~~~f~~pi~~~~~~~~~~~~~~~~~~~~  284 (644)
T 1z3i_X          205 KNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKL  284 (644)
T ss_dssp             CTTCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHHHHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSHHHHHHHHHH
T ss_pred             CChhhHHHHHHHhcccCcEEEEecCcccCCHHHHHHHHHhhCCCcCCCHHHHHHhhcchhhhcCCcCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999888888877888888889


Q ss_pred             HHHHHHhccceeeechhHHhhcCCCcEEEEEEecCCHHHHHHHHHHHHHHHHHh------chhhHHHHHHHHHHhccCcc
Q psy12466        594 SQLAKRTAGFILRRTSDVQASLLNSKRETLLVCRATPLQQSLYLRCVEYWDARA------SRDSHLSVTHALRKICNHPG  667 (680)
Q Consensus       594 ~~L~~~l~~f~lRrtk~~v~~~LP~k~e~~v~v~ms~~Q~~lY~~l~~~~~~~~------~~~~~l~~l~~LRqicnHP~  667 (680)
                      ..|+.++.||++||+++++...||++.+.+++|+||+.|+++|+.+++......      .....+..+++|||+||||.
T Consensus       285 ~~L~~~l~~~~lRR~k~~v~~~LP~k~~~~v~~~ls~~q~~lY~~~~~~~~~~~~~~~g~~~~~~l~~l~~Lrk~c~hp~  364 (644)
T 1z3i_X          285 QELISIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKLCNHPA  364 (644)
T ss_dssp             HHHHHHHHHHEECCCGGGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHHCGGGSSCTTCCCHHHHHHHHHHHHHHHCTH
T ss_pred             HHHHHHHHHHHHHhhHHhHhhhCCCceEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhcCccchhHHHHHHHHHHHhCCHH
Confidence            999999999999999999999999999999999999999999999987764332      23467899999999999999


Q ss_pred             ccCC
Q psy12466        668 LVQQ  671 (680)
Q Consensus       668 L~~~  671 (680)
                      |+..
T Consensus       365 l~~~  368 (644)
T 1z3i_X          365 LIYE  368 (644)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            9853



>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 680
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 8e-53
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 1e-34
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 2e-09
d1z3ix1 346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-09
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 4e-08
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-05
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 3e-04
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]
 Score =  182 bits (461), Expect = 8e-53
 Identities = 113/278 (40%), Positives = 161/278 (57%), Gaps = 9/278 (3%)

Query: 339 LVQQPDVMEEEGQWKHNPSGKPLVDVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLE 398
           LV                  K  V V VD  LS+VL+PHQR+GV FL++ V      +  
Sbjct: 21  LVLYEPPAISAHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSY 80

Query: 399 GAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSSLTSNWNDEFKKWLGLT 458
           G I+ADEMGLGKTLQCI LIWTLL+Q P   P I KV++V+PSSL  NW +E  KWLG  
Sbjct: 81  GCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGR 140

Query: 459 RMC-PYHVNQKNKAEDYVYSRVS--------PVLIISYEMLIRAYQTIVDTEFDLLICDE 509
                     K++ +  + + +S        P+LIISYE      + +   +  L+ICDE
Sbjct: 141 VQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDE 200

Query: 510 GHRLKNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNF 569
           GHRLKN  ++ Y  +  +N ++R+L+SGTP+QNDL E+F L  F N G+LG+ +EF+K F
Sbjct: 201 GHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRF 260

Query: 570 EEPILESRSPNSTEAQKSLGELRSSQLAKRTAGFILRR 607
           E PIL+ R  ++++  ++ GE +  +L       ++RR
Sbjct: 261 EIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRR 298


>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query680
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.8
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.78
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.78
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.71
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.69
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.55
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.42
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.38
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.37
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.32
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.22
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.19
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.14
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.02
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.92
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.9
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.89
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.82
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.77
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.75
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.75
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.73
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.7
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.65
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.62
d1z5za1 244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.39
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.13
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.84
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.48
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.89
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.87
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.85
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.85
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.75
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.42
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.22
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.99
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.89
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.1
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.74
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 93.69
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.64
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.48
d2qy9a2211 GTPase domain of the signal recognition particle r 93.15
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.07
d1okkd2207 GTPase domain of the signal recognition particle r 93.06
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 92.77
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.14
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.11
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 91.94
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.84
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.67
d1vmaa2213 GTPase domain of the signal recognition particle r 91.52
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.83
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.48
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.43
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.41
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.4
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.07
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.4
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.36
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 89.33
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 88.64
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 87.89
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 87.88
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 87.53
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 87.46
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.34
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.52
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 85.37
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.02
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 83.95
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 81.15
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 81.02
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 80.6
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]
Probab=100.00  E-value=1.2e-45  Score=386.41  Aligned_cols=245  Identities=44%  Similarity=0.784  Sum_probs=216.2

Q ss_pred             ccccCcccccccCcccHHHHHHHHHhhhhhccCCCCceEEEcCCCCChHHHHHHHHHHHHhcCCCCCCccceEEEEeccc
Q psy12466        363 DVTVDGFLSRVLKPHQRQGVSFLYERVCDLASLDLEGAILADEMGLGKTLQCIALIWTLLRQGPYGMPVIRKVLIVTPSS  442 (680)
Q Consensus       363 ~~~~p~~l~~~LrpyQ~~gv~~l~~~~~~~~~~~~~g~iLaDemGlGKT~~aiali~~~~~~~~~~~~~~~~~LIV~P~s  442 (680)
                      .+.+||.+...|||||++||+||++++.+.....+.|||||||||+|||+|+|+++..+...++...+..+++|||||.+
T Consensus        45 ~~~~~p~l~~~Lr~hQ~~gv~~l~~~~~~~~~~~~~g~iLaDemGlGKT~qaia~l~~l~~~~~~~~~~~~~~LIV~P~s  124 (298)
T d1z3ix2          45 HVVVDPVLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSS  124 (298)
T ss_dssp             CEECCHHHHTTCCHHHHHHHHHHHHHHTTSSSTTCCEEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHH
T ss_pred             ceeEChhhhccccHHHHHHHHHHHHHHHhhhhccCCceEEEeCCCCCHHHHHHHHHHHHHHhcccccCCCCcEEEEccch
Confidence            45678899999999999999999998766555678899999999999999999999999988876667778899999999


Q ss_pred             hHHHHHHHHHHHhCCC-CeeEeecCCcchhhh----hh----hcCCCCEEEEeHHHHHHHHHhhhccCceEEEEcCcccc
Q psy12466        443 LTSNWNDEFKKWLGLT-RMCPYHVNQKNKAED----YV----YSRVSPVLIISYEMLIRAYQTIVDTEFDLLICDEGHRL  513 (680)
Q Consensus       443 ll~qW~~E~~~~~~~~-~v~~~~~~~~~~~~~----~~----~~~~~~vvI~ty~~l~~~~~~l~~~~~~~vIlDEaH~~  513 (680)
                      ++.||.+||.+|++.. .++.+++........    ..    .....+++|++|+.+..+.+.+...+|++||+||||++
T Consensus       125 l~~qW~~Ei~k~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~i~sy~~~~~~~~~l~~~~~~~vI~DEaH~i  204 (298)
T d1z3ix2         125 LVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRL  204 (298)
T ss_dssp             HHHHHHHHHHHHHGGGCCEEEECSSCHHHHHHHHHHHHCCCSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGC
T ss_pred             hhHHHHHHHHhhcCCceeEEEEeCchHHHHHHHHHHhhhccCccccceEEEEeecccccchhcccccceeeeeccccccc
Confidence            9999999999999863 344444443332211    11    12346799999999999999999999999999999999


Q ss_pred             cCcccHHHHHHHhcccceEEEEeCCCCCCCHHHHHHHHhhhCCCCCCCHHHHHHHhhhhhhccCCCCChHHHHHhhhhHH
Q psy12466        514 KNGKSKLYELMTGLNIRKRILLSGTPLQNDLQEFFYLNDFANPGVLGSLREFRKNFEEPILESRSPNSTEAQKSLGELRS  593 (680)
Q Consensus       514 kn~~s~~~~~l~~l~~~~rllLTgTP~~n~~~el~sll~fl~p~~l~~~~~F~~~f~~~i~~~~~~~~~~~~~~~~~~~~  593 (680)
                      +|..++.++++..+++.+||+|||||++|++.|+|++++||+|+.|++...|.+.|..|+..+...+.+..+...+..+.
T Consensus       205 kn~~s~~~~a~~~l~~~~rllLTGTPi~N~~~dl~~ll~fl~p~~~~~~~~F~~~f~~pi~~~~~~~~~~~~~~~~~~~l  284 (298)
T d1z3ix2         205 KNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKL  284 (298)
T ss_dssp             CTTCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHHHHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSHHHHHHHHHH
T ss_pred             ccccchhhhhhhccccceeeeecchHHhhhhHHHHHHHHHhCCCcCCCHHHHHHHHhhHHHhCcccCCcHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998888888888889999


Q ss_pred             HHHHHHhccceeee
Q psy12466        594 SQLAKRTAGFILRR  607 (680)
Q Consensus       594 ~~L~~~l~~f~lRr  607 (680)
                      .+|+.+++||++||
T Consensus       285 ~~L~~~l~~~~lRR  298 (298)
T d1z3ix2         285 QELISIVNRCLIRR  298 (298)
T ss_dssp             HHHHHHHHHHEECC
T ss_pred             HHHHHHhhhheeCC
Confidence            99999999999998



>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure