Diaphorina citri psyllid: psy1246

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MSACPSSFAEACSGPSPTPANSGLYGNGPSGYTPTEKRPPYGQPENTPPYAPAENRPSYGQSENSPSYGQPENKPSYGQPENRPSYGQPGNGASYGQPENKPSYGQPENKPSYGQPENRPSYGQPENRPSYGQPGNGASYGQPENKPSYGQPENGAKVIMM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSACPSSFAEACSGPSPTPANSGLYGNGPSGYTPTEKRPPYGQPENTPPYAPAENRPSYGQSENSPSYGQPENKPSYGQPENRPSYGQPGNGASYGQPENKPSYGQPENKPSYGQPENRPSYGQPENRPSYGQPGNGASYGQPENKPSYGQPENGAKVIMM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0034399 [CC]nuclear peripheryprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 96-108
View the alignment between query and template
View the model in PyMOL