Diaphorina citri psyllid: psy12488


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MYRSHNKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS
ccccccEEEEEEEcccCEEEcccccccccEEEEEEEcccccccccCEEccccccccEEEcccccccEEEEccEEEEEEEcccEEEEEEEcc
****HNKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRSHNKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
10 kDa chaperonin Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.confidentQ4FPA6
10 kDa chaperonin 3 Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.confidentP35864
10 kDa chaperonin 1 Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.confidentQ98IV4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE3, chain O
Confidence level:very confident
Coverage over the Query: 6-88
View the alignment between query and template
View the model in PyMOL