Diaphorina citri psyllid: psy12489


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
cccEEEEcccHHHHHHHHHHHHHHcccccEEEEEEccccccccEEEEcccccccccEEccCEEEEcccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEEEEEECccccEEEEEcccccCEEccEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccCEEEcccccEEEEEEccccccccccccEEEEEEcccHHHHHccccccHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccEECcccccEEEECcccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHccccccc
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTML*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Renalase Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro (By similarity). Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.confidentQ5U2W9
Renalase Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis (By similarity). According to PubMed:17385068, is unlikely that renalase has physiologically relevant catecholamine-oxidizing activity.confidentQ5VYX0
Renalase Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.confidentA7RDN6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QJ4, chain A
Confidence level:very confident
Coverage over the Query: 1-346
View the alignment between query and template
View the model in PyMOL