Psyllid ID: psy12489


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
cccEEEEcccHHHHHHHHHHHHHHcccccEEEEEEccccccccEEEEcccccccccEEccEEEEEcccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEEEEEEEccccEEEEEcccccEEEccEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccEEEEcccccEEEEEEccccccccccccEEEEEEcccHHHHHccccccHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccc
cccEEEEccHHHHHHHHHHHHHccccccEEEEEEEccccccccEccEcccccccEEEEcccEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccEcccccHHHHHHHHHHHcccEEEEEEEEEEEEEccccccEEEEEccccccccccEEEEEccHHHHHHHHcccccHHHHHHHHHHHHcccccccHEEEEEEcccccccccccEEEcccccEEEEEEccccccccccccEEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccEEcccccEEEEEcccccccccccHHHHHHHHHHcHcHHcHHHHHHHHHHHccccccc
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITiwdkargpggrmttsrsnvvpnckvdlglqyitttpdflsnhtdiyqplldekllepftANIIGYksrkknvthyvtpqgsssIVKYFLNKSNIDEICYNTFLEtmaktdstnqievtskegkkgIFDIVVlsmpapqvtdlfnRSEMMHIALTGAAQVLLDVEYSSryafgmffdkqferpfdikyfddneiIRYISfdnvkrnrpdepisvcVHTTTQYYnsfldsetprNVIERELLDLIRKmfpswplpaetklqtwkysqvvdphrdklgfmqfsakplvicigdsyvpqsnfdgcihsakqttgasmvGKHWMLGLLrywenptmlq
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIwdkargpggrmttsrsnvvpnCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIgyksrkknvthYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYIsfdnvkrnrpdePISVCVHTTTQYynsfldsetprNVIERELLDLIRKMFPswplpaetklqtwKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLrywenptmlq
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
***VLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTD***QIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWE******
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTML*
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARG**********NVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
*KKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNVKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVGKHWMLGLLRYWENPTMLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
A7RDN6342 Renalase OS=Mus musculus yes N/A 0.895 0.956 0.346 4e-53
Q5VYX0342 Renalase OS=Homo sapiens yes N/A 0.895 0.956 0.348 8e-52
Q5U2W9315 Renalase OS=Rattus norveg yes N/A 0.846 0.980 0.349 2e-47
>sp|A7RDN6|RNLS_MOUSE Renalase OS=Mus musculus GN=Rnls PE=2 SV=2 Back     alignment and function desciption
 Score =  209 bits (531), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 118/341 (34%), Positives = 188/341 (55%), Gaps = 14/341 (4%)

Query: 1   MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60
           M +VL+VG+G+T +L + LLR+++ T  +++ +WDK    GGRM T+ S   P C  DLG
Sbjct: 1   MSRVLVVGAGLTGSLCAALLRKEI-TAPLYLGLWDKGGDIGGRMITASSPHNPRCTADLG 59

Query: 61  LQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYF 120
            QYIT +P ++  H + Y+ LL   +L+P T+ I G K ++ +  ++V PQG SS++KY+
Sbjct: 60  AQYITCSPHYVKEHQNFYEELLAHGILKPLTSPIEGMKGKEGDC-NFVAPQGFSSVIKYY 118

Query: 121 LNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEM 180
           L KS  +    +   +   K    N+ EV++  G    FD+V+L+MPAPQ+ +L  + ++
Sbjct: 119 LKKSGAEVSLKHCVTQIHLK---DNKWEVSTDTGSAEQFDLVILTMPAPQILEL--QGDI 173

Query: 181 MHIALTGAAQVLLDVEYSSRYAFGMFFD--KQFERPFDIKYFDDNEIIRYISFDNVKRNR 238
           +++      + L  V YSSRYA G+F++   +   P+  +Y   +  I +IS DN KRN 
Sbjct: 174 VNLISERQREQLKSVSYSSRYALGLFYEVGMKIGVPWSCRYLSSHPCICFISIDNKKRNI 233

Query: 239 PDEPI--SVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYS 296
                  SV + TT  +    L  E     +++ ++  +  + P  P P  T    W YS
Sbjct: 234 ESSECGPSVVIQTTVPFGVQHL--EASEADVQKLMIQQLETILPGLPQPVATICHKWTYS 291

Query: 297 QVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSA 337
           QV     D+ G M    KP ++C GD +   SNF+GCI SA
Sbjct: 292 QVTSSVSDRPGQMTLHLKPFLVCGGDGFT-HSNFNGCISSA 331




Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 4EC: .EC: -EC: .EC: -
>sp|Q5VYX0|RNLS_HUMAN Renalase OS=Homo sapiens GN=RNLS PE=1 SV=1 Back     alignment and function description
>sp|Q5U2W9|RNLS_RAT Renalase OS=Rattus norvegicus GN=Rnls PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
50540280344 renalase [Danio rerio] gi|49903836|gb|AA 0.898 0.953 0.397 2e-62
321459831350 hypothetical protein DAPPUDRAFT_327763 [ 0.890 0.928 0.375 2e-61
387018036344 Renalase-like [Crotalus adamanteus] 0.901 0.956 0.390 7e-59
148231772344 renalase, FAD-dependent amine oxidase [X 0.895 0.950 0.392 1e-57
443700774344 hypothetical protein CAPTEDRAFT_156960 [ 0.906 0.962 0.385 7e-56
329663214342 renalase [Bos taurus] gi|296472880|tpg|D 0.895 0.956 0.381 1e-55
194042443342 PREDICTED: renalase [Sus scrofa] 0.895 0.956 0.378 2e-55
395820756342 PREDICTED: renalase [Otolemur garnettii] 0.895 0.956 0.366 1e-54
348524008343 PREDICTED: renalase-like [Oreochromis ni 0.890 0.947 0.384 5e-54
291404376342 PREDICTED: renalase [Oryctolagus cunicul 0.895 0.956 0.369 6e-54
>gi|50540280|ref|NP_001002607.1| renalase [Danio rerio] gi|49903836|gb|AAH75985.1| Zgc:92286 [Danio rerio] Back     alignment and taxonomy information
 Score =  245 bits (626), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/342 (39%), Positives = 207/342 (60%), Gaps = 14/342 (4%)

Query: 1   MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60
           M +VLIVG+G+T +L + LLR++L  + ++I +WDKARG GGRM+TSRS   P+C VDLG
Sbjct: 1   MSRVLIVGAGLTGSLCACLLRREL-PNKVNIVVWDKARGAGGRMSTSRSPNNPSCSVDLG 59

Query: 61  LQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYF 120
            QYI+ T  +   H+  Y+ LL + +L+P +A + G   +++ + +YVTP G SSIVK++
Sbjct: 60  AQYISATQYYAQIHSSFYEELLAQDILKPLSAPVEGLMVKEEGMVNYVTPHGVSSIVKHY 119

Query: 121 LNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEM 180
           L +S   E+ YN  +  + + D+    EV  KEG    FD+VVL+MP PQ+  L  + ++
Sbjct: 120 LKESAGAEVFYNRHVTHIHRKDTG--WEVCRKEGSPERFDVVVLTMPVPQILQL--QGDV 175

Query: 181 MHIALTGAAQVLLDVEYSSRYAFGMFF--DKQFERPFDIKYFDDNEIIRYISFDNVKRN- 237
             +      + L  V YSSRYA G+F+  D + + P+  KY  +N  IR+I+ D+ KRN 
Sbjct: 176 GSLMGENQRRKLEAVSYSSRYALGLFYKADTRIDVPWAAKYVSNNPCIRFIAIDDKKRNL 235

Query: 238 --RPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKY 295
             +   P SV VHT+  +    L+ E  ++ ++  +L+ ++K+ P  P P   K Q W+Y
Sbjct: 236 ESKVSGP-SVVVHTSVPFGIQHLEEE--KDAVQPIILEELKKLMPELPKPESVKCQKWRY 292

Query: 296 SQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSA 337
           SQV     D  G M   ++PL++C GD +   SNFDGCI SA
Sbjct: 293 SQVTRSVADCPGQMTVLSQPLLVCGGDGFT-HSNFDGCIESA 333




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|321459831|gb|EFX70880.1| hypothetical protein DAPPUDRAFT_327763 [Daphnia pulex] Back     alignment and taxonomy information
>gi|387018036|gb|AFJ51136.1| Renalase-like [Crotalus adamanteus] Back     alignment and taxonomy information
>gi|148231772|ref|NP_001090791.1| renalase, FAD-dependent amine oxidase [Xenopus (Silurana) tropicalis] gi|134025793|gb|AAI35184.1| LOC100037883 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|443700774|gb|ELT99581.1| hypothetical protein CAPTEDRAFT_156960 [Capitella teleta] Back     alignment and taxonomy information
>gi|329663214|ref|NP_001192992.1| renalase [Bos taurus] gi|296472880|tpg|DAA14995.1| TPA: Chromosome 10 open reading frame 59-like [Bos taurus] Back     alignment and taxonomy information
>gi|194042443|ref|XP_001928407.1| PREDICTED: renalase [Sus scrofa] Back     alignment and taxonomy information
>gi|395820756|ref|XP_003783726.1| PREDICTED: renalase [Otolemur garnettii] Back     alignment and taxonomy information
>gi|348524008|ref|XP_003449515.1| PREDICTED: renalase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|291404376|ref|XP_002718540.1| PREDICTED: renalase [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
ZFIN|ZDB-GENE-040718-351344 rnls "renalase, FAD-dependent 0.901 0.956 0.395 1.7e-59
MGI|MGI:1915045342 Rnls "renalase, FAD-dependent 0.895 0.956 0.348 2.2e-50
UNIPROTKB|Q5VYX0342 RNLS "Renalase" [Homo sapiens 0.895 0.956 0.357 5.2e-49
RGD|1309804315 Rnls "renalase, FAD-dependent 0.849 0.984 0.356 4.8e-46
UNIPROTKB|Q48MT7328 PSPPH_1014 "Uncharacterized pr 0.753 0.838 0.236 4.3e-08
UNIPROTKB|Q4K6B1328 PFL_5143 "FAD dependent oxidor 0.150 0.167 0.387 2.4e-06
TAIR|locus:2012030384 AT1G56000 [Arabidopsis thalian 0.736 0.700 0.234 2.4e-05
TAIR|locus:2012005466 AT1G55980 [Arabidopsis thalian 0.736 0.577 0.234 3.4e-05
ZFIN|ZDB-GENE-040718-351 rnls "renalase, FAD-dependent amine oxidase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 610 (219.8 bits), Expect = 1.7e-59, P = 1.7e-59
 Identities = 135/341 (39%), Positives = 206/341 (60%)

Query:     1 MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60
             M +VLIVG+G+T +L + LLR++L  + ++I +WDKARG GGRM+TSRS   P+C VDLG
Sbjct:     1 MSRVLIVGAGLTGSLCACLLRREL-PNKVNIVVWDKARGAGGRMSTSRSPNNPSCSVDLG 59

Query:    61 LQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYF 120
              QYI+ T  +   H+  Y+ LL + +L+P +A + G   +++ + +YVTP G SSIVK++
Sbjct:    60 AQYISATQYYAQIHSSFYEELLAQDILKPLSAPVEGLMVKEEGMVNYVTPHGVSSIVKHY 119

Query:   121 LNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEM 180
             L +S   E+ YN  +  + + D+    EV  KEG    FD+VVL+MP PQ+  L  + ++
Sbjct:   120 LKESAGAEVFYNRHVTHIHRKDTG--WEVCRKEGSPERFDVVVLTMPVPQILQL--QGDV 175

Query:   181 MHIALTGAAQVLLDVEYSSRYAFGMFF--DKQFERPFDIKYFDDNEIIRYISFDNVKRNR 238
               +      + L  V YSSRYA G+F+  D + + P+  KY  +N  IR+I+ D+ KRN 
Sbjct:   176 GSLMGENQRRKLEAVSYSSRYALGLFYKADTRIDVPWAAKYVSNNPCIRFIAIDDKKRNL 235

Query:   239 PDEPI--SVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYS 296
               +    SV VHT+  +    L+ E  ++ ++  +L+ ++K+ P  P P   K Q W+YS
Sbjct:   236 ESKVSGPSVVVHTSVPFGIQHLEEE--KDAVQPIILEELKKLMPELPKPESVKCQKWRYS 293

Query:   297 QVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSA 337
             QV     D  G M   ++PL++C GD +   SNFDGCI SA
Sbjct:   294 QVTRSVADCPGQMTVLSQPLLVCGGDGFT-HSNFDGCIESA 333




GO:0005575 "cellular_component" evidence=ND
MGI|MGI:1915045 Rnls "renalase, FAD-dependent amine oxidase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VYX0 RNLS "Renalase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309804 Rnls "renalase, FAD-dependent amine oxidase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q48MT7 PSPPH_1014 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K6B1 PFL_5143 "FAD dependent oxidoreductase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TAIR|locus:2012030 AT1G56000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012005 AT1G55980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5U2W9RNLS_RAT1, ., 4, ., -, ., -0.34960.84650.9809yesN/A
Q5VYX0RNLS_HUMAN1, ., 4, ., -, ., -0.34890.89580.9561yesN/A
A7RDN6RNLS_MOUSE1, ., 4, ., -, ., -0.34600.89580.9561yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 1e-28
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 1e-08
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 0.004
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
 Score =  113 bits (284), Expect = 1e-28
 Identities = 80/334 (23%), Positives = 128/334 (38%), Gaps = 40/334 (11%)

Query: 1   MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60
           M  + IVG+GI     +Y LR+        +T+++K RG GGR+ T R       + D G
Sbjct: 1   MPSIAIVGAGIAGLAAAYALREAGRE----VTVFEKGRGVGGRLATRRL---DGGRFDHG 53

Query: 61  LQYITT-TPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVT----HYVTPQGSSS 115
            QY       FL       + L D+ L++ +T  +  +             YV   G S+
Sbjct: 54  AQYFKPRDELFL----RAVEALRDDGLVDVWTPAVWTFTGDGSPPRGDEDPYVGEPGMSA 109

Query: 116 IVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLF 175
           + K+         +   T +  +A+TD+   +  T    +   FD VVL++PAPQ   L 
Sbjct: 110 LAKFLATDLT---VVLETRVTEVARTDNDWTLH-TDDGTRHTQFDDVVLAIPAPQTATLL 165

Query: 176 NRSEMMHIALTGA-AQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDNV 234
                    L  A    L DV Y+  ++  + + +  +RP+    F D   + +++ D  
Sbjct: 166 TTDA---DDLPAALRAALADVVYAPCWSAVLGYPQPLDRPWP-GNFVDGHPLAWLARDAS 221

Query: 235 KRNR-PDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSW-----PLPAET 288
           K+   PD  I V V  +  +    LD      VI       +R           P P  +
Sbjct: 222 KKGHVPDGEIWV-VQASPDWSREHLDH-PAEQVIV-----ALRAAAQELDGDRLPEPDWS 274

Query: 289 KLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGD 322
               W+Y+   D              PL  C GD
Sbjct: 275 DAHRWRYAIPNDAVAGPPLDADREL-PLYAC-GD 306


Length = 331

>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 100.0
PLN02268435 probable polyamine oxidase 100.0
PRK12416463 protoporphyrinogen oxidase; Provisional 100.0
PLN02576496 protoporphyrinogen oxidase 100.0
PRK11883451 protoporphyrinogen oxidase; Reviewed 100.0
COG1231450 Monoamine oxidase [Amino acid transport and metabo 100.0
PLN02529 738 lysine-specific histone demethylase 1 100.0
PLN02676487 polyamine oxidase 100.0
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.98
PLN02568539 polyamine oxidase 99.98
PLN03000 881 amine oxidase 99.98
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.97
KOG0029|consensus501 99.97
PLN02976 1713 amine oxidase 99.97
PRK07233434 hypothetical protein; Provisional 99.97
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.96
KOG0685|consensus498 99.96
PRK07208479 hypothetical protein; Provisional 99.95
PLN02612567 phytoene desaturase 99.95
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.94
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.93
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.93
PLN02487569 zeta-carotene desaturase 99.92
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.92
KOG1276|consensus491 99.91
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.9
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.89
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.84
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 99.79
COG3349 485 Uncharacterized conserved protein [Function unknow 99.62
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.59
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.58
COG2081408 Predicted flavoproteins [General function predicti 99.58
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.58
PRK05868372 hypothetical protein; Validated 99.57
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.57
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.57
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.56
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.55
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.55
PRK06847375 hypothetical protein; Provisional 99.54
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.54
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.53
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.53
PRK07236386 hypothetical protein; Provisional 99.53
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.53
PRK09126392 hypothetical protein; Provisional 99.52
PRK08013400 oxidoreductase; Provisional 99.52
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.52
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.5
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.5
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.5
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.5
PRK07045388 putative monooxygenase; Reviewed 99.49
PRK06753373 hypothetical protein; Provisional 99.49
PRK06184 502 hypothetical protein; Provisional 99.49
KOG4254|consensus561 99.48
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.48
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.48
PRK08244 493 hypothetical protein; Provisional 99.48
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.48
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.48
PRK10157428 putative oxidoreductase FixC; Provisional 99.47
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.46
PRK07588391 hypothetical protein; Provisional 99.46
PRK06996398 hypothetical protein; Provisional 99.46
PRK07190 487 hypothetical protein; Provisional 99.45
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.45
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.45
PRK06834 488 hypothetical protein; Provisional 99.45
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.44
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.44
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.43
PRK10015429 oxidoreductase; Provisional 99.43
PRK06126 545 hypothetical protein; Provisional 99.43
PRK07538413 hypothetical protein; Provisional 99.43
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.42
PRK08163396 salicylate hydroxylase; Provisional 99.41
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.41
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.39
PRK11728393 hydroxyglutarate oxidase; Provisional 99.39
PRK08132 547 FAD-dependent oxidoreductase; Provisional 99.38
COG0579429 Predicted dehydrogenase [General function predicti 99.38
PRK11445351 putative oxidoreductase; Provisional 99.36
PRK06185407 hypothetical protein; Provisional 99.36
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.35
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.34
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 99.34
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.33
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.33
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.33
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.32
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.31
PRK06475400 salicylate hydroxylase; Provisional 99.29
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.29
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.26
KOG2820|consensus399 99.26
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.24
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.21
PRK08294 634 phenol 2-monooxygenase; Provisional 99.2
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.19
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.18
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.17
KOG1399|consensus448 99.15
PRK09897 534 hypothetical protein; Provisional 99.15
PTZ00367 567 squalene epoxidase; Provisional 99.14
PLN02985 514 squalene monooxygenase 99.14
KOG2614|consensus420 99.1
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.09
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 99.09
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.08
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.08
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.08
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.07
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.07
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.06
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.06
PRK13339 497 malate:quinone oxidoreductase; Reviewed 99.04
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.04
PRK05257 494 malate:quinone oxidoreductase; Validated 99.03
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.01
PLN02697529 lycopene epsilon cyclase 98.96
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.96
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.95
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.89
PLN02463447 lycopene beta cyclase 98.89
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.86
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.86
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.85
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.83
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.83
PLN02661357 Putative thiazole synthesis 98.82
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.82
PRK08274466 tricarballylate dehydrogenase; Validated 98.81
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 98.77
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.76
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.75
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.75
PRK08401 466 L-aspartate oxidase; Provisional 98.74
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.74
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.74
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.74
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.72
PRK10262321 thioredoxin reductase; Provisional 98.71
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.69
PRK07121 492 hypothetical protein; Validated 98.64
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.63
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.62
PRK06175433 L-aspartate oxidase; Provisional 98.6
PRK07804 541 L-aspartate oxidase; Provisional 98.59
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.59
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.57
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.56
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.56
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.56
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.56
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.56
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.54
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.53
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.52
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.52
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.52
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.52
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.51
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.51
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.49
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 98.49
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 98.49
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.49
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.48
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.48
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.48
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.47
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.47
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.46
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.45
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.44
KOG2415|consensus 621 98.43
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.43
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.42
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.41
PRK08071 510 L-aspartate oxidase; Provisional 98.41
PRK08275 554 putative oxidoreductase; Provisional 98.39
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 98.39
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.38
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.37
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
PRK07395 553 L-aspartate oxidase; Provisional 98.37
PLN02507 499 glutathione reductase 98.37
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.36
PRK12839 572 hypothetical protein; Provisional 98.36
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.36
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.36
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.35
PRK07512 513 L-aspartate oxidase; Provisional 98.33
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.3
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.29
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.29
PTZ00058 561 glutathione reductase; Provisional 98.28
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.27
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 98.26
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 98.25
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.25
PLN02815 594 L-aspartate oxidase 98.22
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.21
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.21
KOG2404|consensus 477 98.19
PRK12831464 putative oxidoreductase; Provisional 98.18
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.17
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.16
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.16
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.15
PLN02852 491 ferredoxin-NADP+ reductase 98.14
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.11
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.09
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.09
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.08
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.07
KOG2844|consensus 856 98.07
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.06
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.06
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.05
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.04
PRK07846451 mycothione reductase; Reviewed 98.03
PTZ00188 506 adrenodoxin reductase; Provisional 98.03
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.02
PRK06116450 glutathione reductase; Validated 98.02
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.01
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.01
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 98.01
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.98
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.98
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.98
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.98
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.97
PRK06370463 mercuric reductase; Validated 97.96
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.96
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.95
PLN02507499 glutathione reductase 97.95
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.95
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.94
TIGR02053 463 MerA mercuric reductase. This model represents the 97.94
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.94
PRK12814652 putative NADPH-dependent glutamate synthase small 97.94
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.94
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.94
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.93
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.93
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.93
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.93
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.92
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.92
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.91
PRK06116450 glutathione reductase; Validated 97.91
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.91
PTZ00052 499 thioredoxin reductase; Provisional 97.9
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.9
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.89
PRK06370463 mercuric reductase; Validated 97.88
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.88
KOG0404|consensus322 97.88
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.87
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.87
TIGR02053463 MerA mercuric reductase. This model represents the 97.87
PRK14694 468 putative mercuric reductase; Provisional 97.86
PRK13748 561 putative mercuric reductase; Provisional 97.85
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.85
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.85
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.84
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.82
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.82
PRK14727 479 putative mercuric reductase; Provisional 97.82
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.82
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.82
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.79
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.78
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.77
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.77
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.76
KOG2665|consensus453 97.76
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.75
KOG2960|consensus328 97.74
KOG0399|consensus2142 97.72
KOG1298|consensus 509 97.72
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.71
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.7
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.7
PRK14694468 putative mercuric reductase; Provisional 97.69
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.67
PTZ00052499 thioredoxin reductase; Provisional 97.67
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.66
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.66
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.65
PRK14727479 putative mercuric reductase; Provisional 97.64
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.64
PRK13512438 coenzyme A disulfide reductase; Provisional 97.64
PRK13984604 putative oxidoreductase; Provisional 97.62
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.6
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.6
PRK13748561 putative mercuric reductase; Provisional 97.6
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.59
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.59
PRK09077 536 L-aspartate oxidase; Provisional 97.56
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 97.55
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.52
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.51
PLN02546 558 glutathione reductase 97.5
PRK02106 560 choline dehydrogenase; Validated 97.49
PTZ00058561 glutathione reductase; Provisional 97.49
COG3573 552 Predicted oxidoreductase [General function predict 97.48
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.48
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.45
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.41
KOG2852|consensus380 97.4
KOG1800|consensus468 97.39
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.39
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 97.38
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.37
PTZ00153659 lipoamide dehydrogenase; Provisional 97.37
KOG3855|consensus481 97.37
PLN02546558 glutathione reductase 97.35
KOG2853|consensus509 97.34
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.33
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.31
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.31
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.29
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.27
KOG0042|consensus 680 97.24
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.24
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.23
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 97.19
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.18
KOG1335|consensus 506 97.06
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.98
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.96
PLN02785 587 Protein HOTHEAD 96.94
PRK10262321 thioredoxin reductase; Provisional 96.92
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.84
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.76
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.64
KOG1336|consensus478 96.63
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 96.59
KOG1335|consensus506 96.58
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.58
PRK07846 451 mycothione reductase; Reviewed 96.55
KOG3923|consensus342 96.43
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.43
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 96.36
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.27
KOG2755|consensus334 96.13
KOG1238|consensus 623 96.1
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.1
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.03
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.0
KOG1336|consensus 478 95.9
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.89
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 95.86
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.65
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.57
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.56
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.53
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.46
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.42
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.39
KOG4716|consensus 503 95.34
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.33
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.33
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.29
KOG1346|consensus659 95.28
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.25
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.23
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.23
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.22
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.07
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.86
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.86
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.71
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.67
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 94.65
PRK06223307 malate dehydrogenase; Reviewed 94.57
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.56
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.54
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.54
COG4716 587 Myosin-crossreactive antigen [Function unknown] 94.44
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.44
KOG0405|consensus478 94.4
PRK12921305 2-dehydropantoate 2-reductase; Provisional 94.4
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.39
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 94.32
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.27
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.26
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 94.23
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.19
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.14
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 94.13
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 94.06
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 93.92
PLN02353 473 probable UDP-glucose 6-dehydrogenase 93.89
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.88
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.76
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 93.67
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.61
KOG2304|consensus298 93.6
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 93.6
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.6
PRK06719157 precorrin-2 dehydrogenase; Validated 93.56
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.56
PRK12831464 putative oxidoreductase; Provisional 93.55
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.52
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.5
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.37
PRK12770352 putative glutamate synthase subunit beta; Provisio 93.29
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.27
PRK07417279 arogenate dehydrogenase; Reviewed 93.25
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 93.23
PRK04148134 hypothetical protein; Provisional 93.11
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.89
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.86
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.78
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.71
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.69
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 92.66
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.65
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 92.59
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.57
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.55
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 92.49
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 92.43
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 92.38
PRK11730715 fadB multifunctional fatty acid oxidation complex 92.35
PTZ00082321 L-lactate dehydrogenase; Provisional 92.26
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.17
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 92.12
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.08
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.07
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 92.04
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.0
COG2085211 Predicted dinucleotide-binding enzymes [General fu 91.98
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 91.96
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 91.91
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 91.9
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.8
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 91.8
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 91.73
PRK07502307 cyclohexadienyl dehydrogenase; Validated 91.73
PRK12549284 shikimate 5-dehydrogenase; Reviewed 91.69
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 91.68
KOG2311|consensus 679 91.64
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 91.55
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 91.52
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 91.51
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.42
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 91.42
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 91.31
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 91.3
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.29
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 91.24
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 91.2
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.04
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.02
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 90.91
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.79
PTZ00325321 malate dehydrogenase; Provisional 90.73
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 90.59
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 90.59
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 90.54
PRK11154708 fadJ multifunctional fatty acid oxidation complex 90.5
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.36
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 90.34
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 90.2
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 90.15
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 90.13
PRK11908347 NAD-dependent epimerase/dehydratase family protein 90.06
PRK09496453 trkA potassium transporter peripheral membrane com 90.06
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 90.06
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 90.05
PRK15116268 sulfur acceptor protein CsdL; Provisional 90.04
PRK08017256 oxidoreductase; Provisional 90.02
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 89.97
KOG3851|consensus446 89.92
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.91
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.84
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 89.73
PLN02256304 arogenate dehydrogenase 89.71
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 89.7
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 89.67
PRK09496453 trkA potassium transporter peripheral membrane com 89.58
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.44
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 89.42
cd01483143 E1_enzyme_family Superfamily of activating enzymes 89.37
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 89.35
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 89.33
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.33
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 89.08
PRK12779 944 putative bifunctional glutamate synthase subunit b 89.02
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 88.94
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 88.93
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 88.91
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.4e-52  Score=351.50  Aligned_cols=322  Identities=23%  Similarity=0.388  Sum_probs=274.0

Q ss_pred             CCcEEEEccCHHHHHHHHHHHHhcCCCceeEEEEecCCCCCccceeecCCCCCCeeeecccceeecC-hhcchhHHHhhh
Q psy12489          1 MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTT-PDFLSNHTDIYQ   79 (365)
Q Consensus         1 m~~v~IIGaG~aGl~~A~~L~~~g~~~~~~v~v~E~~~~~ggr~~t~~~~~~~~~~~d~g~~~~~~~-~~~~~~~~~~~~   79 (365)
                      |.+|+|||+||+||+||+.|+++|    +.|+||||++.+|||+.|++..   +..+|+|+++|++. +.|.    ++++
T Consensus         1 ~~siaIVGaGiAGl~aA~~L~~aG----~~vtV~eKg~GvGGRlAtRRl~---~g~~DhGAqYfk~~~~~F~----~~Ve   69 (331)
T COG3380           1 MPSIAIVGAGIAGLAAAYALREAG----REVTVFEKGRGVGGRLATRRLD---GGRFDHGAQYFKPRDELFL----RAVE   69 (331)
T ss_pred             CCcEEEEccchHHHHHHHHHHhcC----cEEEEEEcCCCcccchheeccC---CccccccceeecCCchHHH----HHHH
Confidence            789999999999999999999998    9999999999999999999985   45699999999984 3343    7788


Q ss_pred             hhhhcCcccccccccccc-----cccCCCcceEEcCCChHHHHHHHHhhCCCceEEEeeeeEEeeecCCCCcEEEEecCC
Q psy12489         80 PLLDEKLLEPFTANIIGY-----KSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEG  154 (365)
Q Consensus        80 ~l~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~g~~~l~~~l~~~~g~~~i~~~~~V~~i~~~~~~~~~~v~~~~g  154 (365)
                      .|.+.|++..|......+     +.. .....|...+||.++.+.|+.  + .+|+++++|+.|.+.+  +.|++.+++|
T Consensus        70 ~~~~~glV~~W~~~~~~~~~~~~~~~-~d~~pyvg~pgmsalak~LAt--d-L~V~~~~rVt~v~~~~--~~W~l~~~~g  143 (331)
T COG3380          70 ALRDDGLVDVWTPAVWTFTGDGSPPR-GDEDPYVGEPGMSALAKFLAT--D-LTVVLETRVTEVARTD--NDWTLHTDDG  143 (331)
T ss_pred             HHHhCCceeeccccccccccCCCCCC-CCCCccccCcchHHHHHHHhc--c-chhhhhhhhhhheecC--CeeEEEecCC
Confidence            899999999996542221     111 122239999999999999987  4 7899999999999998  9999999776


Q ss_pred             -CeeecCEEEEcCChhhHHHhhccccccccchHHHHHHhhcCCccceeEEEEeccCCCCCCcceEEecCCCcEEEeeecC
Q psy12489        155 -KKGIFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDN  233 (365)
Q Consensus       155 -~~~~~d~vV~a~p~~~~~~ll~~~~~~~~l~~~~~~~~~~~~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  233 (365)
                       +...+|.||+|+|.|++..||....  ..+|++++..+..+.|.||+++++.|..+.+.|+.++++ ++.++.|+..++
T Consensus       144 ~~~~~~d~vvla~PAPQ~~~LLt~~~--~~~p~~l~~~~a~V~y~Pc~s~~lg~~q~l~~P~~G~~v-dg~~laWla~d~  220 (331)
T COG3380         144 TRHTQFDDVVLAIPAPQTATLLTTDA--DDLPAALRAALADVVYAPCWSAVLGYPQPLDRPWPGNFV-DGHPLAWLARDA  220 (331)
T ss_pred             CcccccceEEEecCCCcchhhcCccc--ccchHHHHHhhccceehhHHHHHhcCCccCCCCCCCccc-CCCeeeeeeccc
Confidence             4678999999999999999997543  568999999999999999999999999999899999766 556999999998


Q ss_pred             CCCCCCCCCceEEEEeChhhhhhhcCCCCchhhHHHHHHHHHHhHCC-CCCCCceEeeecCCCCCCcCCCCCcccceeec
Q psy12489        234 VKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFP-SWPLPAETKLQTWKYSQVVDPHRDKLGFMQFS  312 (365)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~l~~~~~-~~~~~~~~~~~rw~~a~~~~~~~~~~~~~~~~  312 (365)
                      +|+++.+.+..++++++.+|++++++.++|+  .+..+.....++++ ..++|.+...|+|+|+.|.....  ..++...
T Consensus       221 sK~g~~p~~~~~vvqasp~wSr~h~~~~~e~--~i~~l~aA~~~~~~~~~~~p~~s~~H~WrYA~P~~~~~--~~~L~ad  296 (331)
T COG3380         221 SKKGHVPDGEIWVVQASPDWSREHLDHPAEQ--VIVALRAAAQELDGDRLPEPDWSDAHRWRYAIPNDAVA--GPPLDAD  296 (331)
T ss_pred             cCCCCCCcCceEEEEeCchHHHHhhcCCHHH--HHHHHHHhhhhccCCCCCcchHHHhhcccccccccccc--CCccccC
Confidence            9988766677999999999999999999888  88888888888877 36789999999999999987653  2345433


Q ss_pred             CCCeEEEecccccCCCchhHHHHHHHHHHhhhhcc
Q psy12489        313 AKPLVICIGDSYVPQSNFDGCIHSAKQTTGASMVG  347 (365)
Q Consensus       313 ~~~~l~~aGd~~~~~~~~~gA~~SG~~aA~~l~~~  347 (365)
                      ...+|++||||+. ++.+|||+.||..+|+.|+.+
T Consensus       297 ~~~~l~~cGDwc~-GgrVEgA~LSGlAaA~~i~~~  330 (331)
T COG3380         297 RELPLYACGDWCA-GGRVEGAVLSGLAAADHILNG  330 (331)
T ss_pred             CCCceeeeccccc-CcchhHHHhccHHHHHHHHhc
Confidence            3457999999999 999999999999999999753



>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
3qj4_A342 Crystal Structure Of Human Renalase (Isoform 1) Len 9e-53
>pdb|3QJ4|A Chain A, Crystal Structure Of Human Renalase (Isoform 1) Length = 342 Back     alignment and structure

Iteration: 1

Score = 204 bits (518), Expect = 9e-53, Method: Compositional matrix adjust. Identities = 119/341 (34%), Positives = 187/341 (54%), Gaps = 14/341 (4%) Query: 1 MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60 M +VLIVG+G+T +L + LLR++ + +++ +WDKA GGRMTT+ S P C DLG Sbjct: 1 MAQVLIVGAGMTGSLCAALLRRQT-SGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLG 59 Query: 61 LQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYF 120 QYIT TP + H Y LL +L P ++ I G ++ + ++V PQG SSI+K++ Sbjct: 60 AQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDC-NFVAPQGISSIIKHY 118 Query: 121 LNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEM 180 L +S + + + + D + EV+ + G FD++VL+MP P++ L + ++ Sbjct: 119 LKESGAEVYFRHRVTQINLRDD---KWEVSKQTGSPEQFDLIVLTMPVPEILQL--QGDI 173 Query: 181 MHIALTGAAQVLLDVEYSSRYAFGMFFDK--QFERPFDIKYFDDNEIIRYISFDNVKRNR 238 + Q L V YSSRYA G+F++ + + P+ +Y N IR++S DN KRN Sbjct: 174 TTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNI 233 Query: 239 PDEPI--SVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYS 296 I S+ +HTT + ++L+ ++ + + + P P P TK Q W++S Sbjct: 234 ESSEIGPSLVIHTTVPFGVTYLEHSIED--VQELVFQQLENILPGLPQPIATKCQKWRHS 291 Query: 297 QVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSA 337 QV + + G M KP + C GD + QSNFDGCI SA Sbjct: 292 QVTNAAANCPGQMTLHHKPFLACGGDGFT-QSNFDGCITSA 331

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 3e-47
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 3e-35
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 7e-05
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 3e-04
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 4e-04
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
 Score =  162 bits (410), Expect = 3e-47
 Identities = 118/341 (34%), Positives = 177/341 (51%), Gaps = 10/341 (2%)

Query: 1   MKKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLG 60
           M +VLIVG+G+T +L + LLR++    L ++ +WDKA   GGRMTT+ S   P C  DLG
Sbjct: 1   MAQVLIVGAGMTGSLCAALLRRQTSGPL-YLAVWDKADDSGGRMTTACSPHNPQCTADLG 59

Query: 61  LQYITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYF 120
            QYIT TP +   H   Y  LL   +L P ++ I G   ++ +  ++V PQG SSI+K++
Sbjct: 60  AQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGD-CNFVAPQGISSIIKHY 118

Query: 121 LNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTDLFNRSEM 180
           L +S   E+ +   +  +   D  ++ EV+ + G    FD++VL+MP P++  L      
Sbjct: 119 LKESG-AEVYFRHRVTQINLRD--DKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITT 175

Query: 181 MHIALTGAAQVLLDVEYSSRYAFGMFFDK--QFERPFDIKYFDDNEIIRYISFDNVKRNR 238
           +        Q L  V YSSRYA G+F++   + + P+  +Y   N  IR++S DN KRN 
Sbjct: 176 LISEC--QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNI 233

Query: 239 PDEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQV 298
               I   +   T         E     ++  +   +  + P  P P  TK Q W++SQV
Sbjct: 234 ESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQV 293

Query: 299 VDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQ 339
            +   +  G M    KP + C GD +  QSNFDGCI SA  
Sbjct: 294 TNAAANCPGQMTLHHKPFLACGGDGFT-QSNFDGCITSALC 333


>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 100.0
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 100.0
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 100.0
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 100.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 100.0
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.98
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.97
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.97
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.97
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.97
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.97
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.97
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.97
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.96
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.96
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.96
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.96
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.96
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.96
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.96
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.96
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.96
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.95
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.92
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.92
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.9
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.75
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.72
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.67
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.66
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.59
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.58
3dme_A369 Conserved exported protein; structural genomics, P 99.57
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.56
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.55
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.54
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.53
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.52
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.51
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.51
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.5
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.49
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.49
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.48
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.47
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.47
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.47
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.46
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.44
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.44
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.42
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.42
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.42
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.42
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.4
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.37
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.35
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.34
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.34
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.34
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 99.33
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.32
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.31
3atr_A453 Conserved archaeal protein; saturating double bond 99.3
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.29
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.28
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.27
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.26
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.26
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.24
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.22
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.22
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.2
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.18
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.17
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.17
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.15
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.13
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.13
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.12
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.12
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.12
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.11
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.1
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.1
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.09
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.09
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.08
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.08
2bry_A497 NEDD9 interacting protein with calponin homology a 99.06
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.05
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.04
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.01
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.98
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.97
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.97
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.97
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.97
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.96
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.94
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.93
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.91
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.9
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.87
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.87
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.86
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.86
2cul_A232 Glucose-inhibited division protein A-related PROT 98.86
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.85
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.84
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.82
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.81
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.8
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.79
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.78
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.78
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.78
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.77
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.76
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.75
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.74
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.74
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.72
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.72
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.71
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.69
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.69
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.67
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.67
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.67
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.66
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.64
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.64
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.63
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.62
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.62
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.61
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.61
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.61
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.6
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.59
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.58
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.58
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.57
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.56
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.56
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.55
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.53
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.53
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.53
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.52
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.51
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.51
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.5
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.48
1ojt_A 482 Surface protein; redox-active center, glycolysis, 98.48
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.48
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.48
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.48
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.46
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.44
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.42
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.41
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.36
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.35
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.35
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.34
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.33
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.3
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.28
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.27
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.25
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.23
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.23
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.22
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.22
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.21
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.2
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.18
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.18
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.18
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.16
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.15
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.14
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.14
4dna_A463 Probable glutathione reductase; structural genomic 98.14
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.14
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.12
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.11
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.1
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.1
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.1
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.09
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.09
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.09
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.07
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.06
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.05
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.05
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.05
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.05
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.05
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.04
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.04
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.03
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.02
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.99
1fec_A 490 Trypanothione reductase; redox-active center, oxid 97.98
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.98
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.98
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.97
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.97
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 97.96
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.96
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.95
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.95
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.95
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.94
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.93
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.93
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.93
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.92
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 97.9
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.9
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.88
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.86
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.85
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.85
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.84
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.84
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.83
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.83
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.82
4dna_A463 Probable glutathione reductase; structural genomic 97.82
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.79
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.79
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.77
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.76
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.75
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.74
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.74
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.69
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.62
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.62
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.62
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.62
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.59
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.56
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.55
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.53
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.5
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.5
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.5
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.47
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.47
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.45
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.44
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.41
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.41
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.39
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.37
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.35
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.31
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.3
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.27
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.24
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.23
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.2
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.2
1vg0_A650 RAB proteins geranylgeranyltransferase component A 97.18
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.17
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.15
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 97.13
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.1
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.05
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.96
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.7
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.52
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.51
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.36
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.25
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.22
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.2
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.19
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.18
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.13
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.13
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.11
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.06
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 96.0
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.77
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 95.75
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 95.73
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.66
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.61
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.47
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 95.43
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.41
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 95.4
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 95.4
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 95.37
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.33
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.31
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 95.18
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.18
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.16
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.12
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.12
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.02
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 95.01
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.98
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 94.97
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.93
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.89
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.87
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 94.84
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.78
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 94.78
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.77
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 94.75
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 94.73
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 94.72
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 94.67
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.66
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 94.62
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.53
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.52
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.51
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 94.51
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 94.4
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 94.33
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 94.33
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 94.24
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.22
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.22
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.22
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 94.21
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.2
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.19
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.17
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 94.17
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 94.16
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.14
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.13
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.11
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.1
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.09
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.05
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.05
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 94.02
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 94.01
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.0
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 93.99
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.96
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 93.94
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.94
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.94
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 93.92
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 93.91
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 93.9
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.89
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.85
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 93.81
3l6d_A306 Putative oxidoreductase; structural genomics, prot 93.63
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 93.56
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.53
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.5
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 93.49
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 93.45
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 93.44
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.41
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 93.4
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 93.37
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 93.31
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 93.3
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 93.29
3tl2_A315 Malate dehydrogenase; center for structural genomi 93.29
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.27
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 93.21
4g65_A461 TRK system potassium uptake protein TRKA; structur 93.2
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 93.2
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 93.18
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.18
3qha_A296 Putative oxidoreductase; seattle structural genomi 93.1
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.09
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 93.03
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 93.02
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.94
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 92.92
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 92.89
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.88
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 92.87
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.86
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 92.82
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 92.78
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 92.77
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 92.73
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.73
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 92.69
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 92.68
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 92.66
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 92.6
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 92.6
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.59
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.56
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 92.51
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.45
1vpd_A299 Tartronate semialdehyde reductase; structural geno 92.33
1yb4_A295 Tartronic semialdehyde reductase; structural genom 92.32
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 92.31
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.3
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 92.29
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.27
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 92.27
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 92.25
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.18
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 92.15
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 92.12
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 92.08
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 92.06
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 92.01
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.0
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.96
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 91.96
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 91.91
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 91.87
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 91.86
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 91.84
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 91.76
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 91.73
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.71
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 91.71
4ezb_A317 Uncharacterized conserved protein; structural geno 91.68
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 91.61
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 91.61
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 91.53
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 91.52
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 91.41
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 91.41
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 91.39
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.38
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 91.29
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.2
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.17
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 91.01
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 90.93
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.92
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 90.88
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 90.81
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.76
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 90.76
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 90.65
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 90.65
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 90.61
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 90.59
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 90.58
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 90.54
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 90.53
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 90.48
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 90.46
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.41
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 90.36
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.36
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 90.35
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 90.33
3slg_A372 PBGP3 protein; structural genomics, seattle struct 90.32
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 90.32
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 90.31
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 90.27
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 90.22
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 90.21
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 90.16
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.13
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 90.12
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 90.11
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 89.97
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 89.94
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 89.93
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.92
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 89.91
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 89.9
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 89.89
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.88
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 89.83
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 89.78
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 89.68
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 89.55
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 89.52
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 89.51
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 89.51
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 89.45
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 89.44
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 89.43
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 89.41
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1e-46  Score=348.12  Aligned_cols=333  Identities=36%  Similarity=0.628  Sum_probs=276.9

Q ss_pred             CCcEEEEccCHHHHHHHHHHHH---hcCCCceeEEEEecCCCCCccceeecCCCCCCeeeecccceeecChhcchhHHHh
Q psy12489          1 MKKVLIVGSGITSALTSYLLRQ---KLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITTTPDFLSNHTDI   77 (365)
Q Consensus         1 m~~v~IIGaG~aGl~~A~~L~~---~g~~~~~~v~v~E~~~~~ggr~~t~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~   77 (365)
                      |+||+|||||++||++|+.|++   +|    ++|+||||++.+||++.+.+.....+..+++|.++++..+.+...+..+
T Consensus         1 m~dV~IIGaG~aGl~~A~~L~~~~~~G----~~V~v~Ek~~~~gg~~~~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~   76 (342)
T 3qj4_A            1 MAQVLIVGAGMTGSLCAALLRRQTSGP----LYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRF   76 (342)
T ss_dssp             CEEEEEECCSHHHHHHHHHHHSCC-CC----EEEEEECSSSSSCGGGCEEECSSCTTCEEESSCCCEEECSSHHHHTHHH
T ss_pred             CCcEEEECCcHHHHHHHHHHHhhccCC----ceEEEEECCCCCccceeeeecCCCCCceEecCCceEEcCchHHHHHHHH
Confidence            8899999999999999999999   87    9999999999999999988765445678999999988765444344566


Q ss_pred             hhhhhhcCcccccccccccccccCCCcceEEcCCChHHHHHHHHhhCCCceEEEeeeeEEeeecCCCCcEEEEecCCCee
Q psy12489         78 YQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLNKSNIDEICYNTFLETMAKTDSTNQIEVTSKEGKKG  157 (365)
Q Consensus        78 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~l~~~~g~~~i~~~~~V~~i~~~~~~~~~~v~~~~g~~~  157 (365)
                      ++.+...+....|.....+... ......|...+|+.++++.+++.++ .+|+++++|++|+.++  ++|.|++.+|+++
T Consensus        77 ~~~~~~~g~~~~~~~~~~~~~~-~~~~~~~~~~~g~~~l~~~l~~~~g-~~i~~~~~V~~i~~~~--~~~~v~~~~g~~~  152 (342)
T 3qj4_A           77 YDELLAYGVLRPLSSPIEGMVM-KEGDCNFVAPQGISSIIKHYLKESG-AEVYFRHRVTQINLRD--DKWEVSKQTGSPE  152 (342)
T ss_dssp             HHHHHHTTSCEECCSCEETCCC---CCEEEECTTCTTHHHHHHHHHHT-CEEESSCCEEEEEECS--SSEEEEESSSCCE
T ss_pred             HHHHHhCCCeecCchhhcceec-cCCccceecCCCHHHHHHHHHHhcC-CEEEeCCEEEEEEEcC--CEEEEEECCCCEE
Confidence            7777777877788765433322 1345578889999999999999888 9999999999999988  8899999988878


Q ss_pred             ecCEEEEcCChhhHHHhhccccccccchHHHHHHhhcCCccceeEEEEeccCCC--CCCcceEEecCCCcEEEeeecCCC
Q psy12489        158 IFDIVVLSMPAPQVTDLFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQF--ERPFDIKYFDDNEIIRYISFDNVK  235 (365)
Q Consensus       158 ~~d~vV~a~p~~~~~~ll~~~~~~~~l~~~~~~~~~~~~~~~~~~v~l~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~  235 (365)
                      .+|.||+|+|++++.+|+.+..  |.||+.....+..++|.++.++++.|++++  ..++.+++++++..+.|++.+++|
T Consensus       153 ~ad~vV~A~p~~~~~~ll~~~~--~~l~~~~~~~l~~~~~~~~~~v~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~k  230 (342)
T 3qj4_A          153 QFDLIVLTMPVPEILQLQGDIT--TLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKK  230 (342)
T ss_dssp             EESEEEECSCHHHHTTCBSTHH--HHSCHHHHHHHHTCCBCCEEEEEEECSSCC--CCSCSEEECSSCSSEEEEEEHHHH
T ss_pred             EcCEEEECCCHHHHHHHhcccc--cccCHHHHHHHhcCCccccEEEEEEECCCCccCCceeeEEccCCcceEEEEccccC
Confidence            9999999999999999887543  567888899999999999999999999863  457888887765568999888888


Q ss_pred             CCCC--CCCceEEEEeChhhhhhhcCCCCchhhHHHHHHHHHHhHCCCCCCCceEeeecCCCCCCcCCCCCcccceeecC
Q psy12489        236 RNRP--DEPISVCVHTTTQYYNSFLDSETPRNVIERELLDLIRKMFPSWPLPAETKLQTWKYSQVVDPHRDKLGFMQFSA  313 (365)
Q Consensus       236 ~~~~--~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~l~~~~~~~~~~~~~~~~rw~~a~~~~~~~~~~~~~~~~~  313 (365)
                      +++.  +.+..++++.+..|+.++.+.++++  +.+.++++|.++++...+|.+..++||+|+.|.+.....+..+....
T Consensus       231 ~~r~~~~~~~~~v~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~g~~~~p~~~~v~rW~~a~p~~~~~~~~~~~~~~~  308 (342)
T 3qj4_A          231 RNIESSEIGPSLVIHTTVPFGVTYLEHSIED--VQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHH  308 (342)
T ss_dssp             TTCCCC-CCCEEEEEECHHHHHHTTTSCHHH--HHHHHHHHHHHHSCSCCCCSEEEEEEETTCSBSSCCSSSCSCEEEET
T ss_pred             CCCCCCCCCceEEEECCHHHHHHhhcCCHHH--HHHHHHHHHHHhccCCCCCceeeeccccccccccccCCCcceeEecC
Confidence            8743  2345788999999998888888888  99999999999999767899999999999999875432344554345


Q ss_pred             CCeEEEecccccCCCchhHHHHHHHHHHhhhhc
Q psy12489        314 KPLVICIGDSYVPQSNFDGCIHSAKQTTGASMV  346 (365)
Q Consensus       314 ~~~l~~aGd~~~~~~~~~gA~~SG~~aA~~l~~  346 (365)
                      .++|++||||+. ++++|+|+.||++||++|+.
T Consensus       309 ~~~l~laGd~~~-g~~v~~ai~sg~~aa~~i~~  340 (342)
T 3qj4_A          309 KPFLACGGDGFT-QSNFDGCITSALCVLEALKN  340 (342)
T ss_dssp             TTEEEECSGGGS-CSSHHHHHHHHHHHHHHHTT
T ss_pred             CccEEEEccccC-CCCccHHHHHHHHHHHHHHh
Confidence            578999999999 99999999999999999975



>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-10
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-07
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 4e-07
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 3e-05
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 4e-05
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-04
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 1e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 8e-04
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Myxococcus xanthus [TaxId: 34]
 Score = 58.6 bits (140), Expect = 3e-10
 Identities = 35/352 (9%), Positives = 84/352 (23%), Gaps = 26/352 (7%)

Query: 3   KVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQ 62
            V +VG GI+    ++ LR +         + + +   GG + T     +    V+ G  
Sbjct: 2   NVAVVGGGISGLAVAHHLRSRGT----DAVLLESSARLGGAVGTHA---LAGYLVEQGPN 54

Query: 63  YITTTPDFLSNHTDIYQPLLDEKLLEPFTANIIGYKSRKKNVTHYVTPQGSSSIVKYFLN 122
                                 +  +P       Y   +        P   +S +     
Sbjct: 55  SFLDREPATRALAAALNLEGRIRAADPAAKRRYVYTRGRLRSVPASPPAFLASDILPLGA 114

Query: 123 KSNIDEIC---------YNTFLETMAKTDSTNQIEVTSKEGKKGIFDIVVLSMPAPQVTD 173
           +  +               +      +       +V     + GI+   V  +       
Sbjct: 115 RLRVAGELFSRRAPEGVDESLAAFGRRHLGHRATQVLLDAVQTGIYAGDVEQLSVAATFP 174

Query: 174 LFNRSEMMHIALTGAAQVLLDVEYSSRYAFGMFFDKQFERPFDIKYFDDNEIIRYISFDN 233
           +  + E  H +L   A      +  +    G                    +I  ++   
Sbjct: 175 MLVKMEREHRSLILGAIRAQKAQRQAALPAGTAPKLSGALSTFDGGLQ--VLIDALAASL 232

Query: 234 VKRNRPDEPISVCVHTTTQYYNSFLDSETPRNVIERELL-----DLIRKMFPSWPLPAET 288
                    +         +     +      +   +++         K+          
Sbjct: 233 GDAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLDDALAA 292

Query: 289 KLQTWKYSQVVDPHRDKLGFMQFSAKPLVICIGDSYVPQSNFDGCIHSAKQT 340
            +        ++        +     P +  IG++Y      + CI +A Q 
Sbjct: 293 LVAGIYNLGHLERVAAIDAAL--QRLPGLHLIGNAYKGVG-LNDCIRNAAQL 341


>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.86
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.85
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.83
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.83
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.72
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.63
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.62
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.62
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.59
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.57
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.54
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.52
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.44
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.43
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.36
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.31
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.3
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.16
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.13
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.11
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.06
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.06
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.05
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.05
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.02
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.02
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.01
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.01
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.0
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.99
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.94
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.93
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.9
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.84
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.79
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.79
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.78
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.75
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.74
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.73
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.72
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.72
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.71
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.71
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.7
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.69
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.68
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.67
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.67
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.63
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.63
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.62
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.59
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.59
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.57
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.53
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.53
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.5
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.49
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.48
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.47
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.44
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.42
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.39
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.35
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.33
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.31
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.28
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.28
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.26
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.21
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.2
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.17
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.16
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.16
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.13
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.11
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.1
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.02
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.98
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.93
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.93
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.81
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.81
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.78
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.65
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.63
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.48
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.45
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.33
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.32
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.22
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.04
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.02
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.91
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.78
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.77
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.75
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.67
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.67
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.63
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.63
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.56
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.51
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.42
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 96.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.35
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.32
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.29
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.21
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.14
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 95.92
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.77
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.6
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.48
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.42
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.28
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.24
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.13
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.91
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.9
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.88
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.87
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.82
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.78
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.76
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.68
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.67
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.64
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.61
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.59
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.41
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.31
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.25
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.2
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.15
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.14
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.08
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.07
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.04
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.95
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.93
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.81
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 93.8
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 93.77
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.74
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.7
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.65
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.59
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.58
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.08
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 92.89
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.46
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.42
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.39
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.22
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 92.08
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 92.01
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.92
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 91.87
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 91.83
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 91.74
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.38
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.25
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.25
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.2
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.83
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.78
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.74
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.48
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 90.41
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 90.38
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.19
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 89.9
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 89.85
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 89.31
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.29
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 89.25
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.16
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 89.12
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.88
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.85
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.81
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.89
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 87.79
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 87.06
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 86.88
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.78
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 86.46
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 86.32
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.71
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 84.86
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.57
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 84.27
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 84.2
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 83.57
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 83.33
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 83.03
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 82.56
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 82.5
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 82.38
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 82.21
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 82.03
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.13
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 81.01
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 80.83
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 80.56
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 80.51
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.51
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.11
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Myxococcus xanthus [TaxId: 34]
Probab=99.86  E-value=2.5e-21  Score=172.72  Aligned_cols=164  Identities=18%  Similarity=0.189  Sum_probs=115.1

Q ss_pred             CcEEEEccCHHHHHHHHHHHHhcCCCceeEEEEecCCCCCccceeecCCCCCCeeeecccceeec-ChhcchhHHHhhhh
Q psy12489          2 KKVLIVGSGITSALTSYLLRQKLLTDLIHITIWDKARGPGGRMTTSRSNVVPNCKVDLGLQYITT-TPDFLSNHTDIYQP   80 (365)
Q Consensus         2 ~~v~IIGaG~aGl~~A~~L~~~g~~~~~~v~v~E~~~~~ggr~~t~~~~~~~~~~~d~g~~~~~~-~~~~~~~~~~~~~~   80 (365)
                      +||+|||||++||+||+.|+++|    ++|+||||++++||++.|...+   ++.+|.|++++.. ++.+.    .+++.
T Consensus         1 m~V~IIGaG~aGL~aA~~L~~~G----~~V~vlE~~~~~GG~~~t~~~~---g~~~d~G~~~~~~~~~~~~----~l~~~   69 (347)
T d2ivda1           1 MNVAVVGGGISGLAVAHHLRSRG----TDAVLLESSARLGGAVGTHALA---GYLVEQGPNSFLDREPATR----ALAAA   69 (347)
T ss_dssp             CCEEEECCBHHHHHHHHHHHTTT----CCEEEECSSSSSBTTCCEEEET---TEEEESSCCCEETTCHHHH----HHHHH
T ss_pred             CeEEEECCCHHHHHHHHHHHhCC----CCEEEEecCCCCCceEEEEeeC---CEEEecCceEEecCCHHHH----HHHHH
Confidence            47999999999999999999998    9999999999999999998763   6889999988876 33222    12111


Q ss_pred             hhhcC----------------------------------c-------------cccccccc-------------------
Q psy12489         81 LLDEK----------------------------------L-------------LEPFTANI-------------------   94 (365)
Q Consensus        81 l~~~~----------------------------------~-------------~~~~~~~~-------------------   94 (365)
                      +....                                  .             ...+....                   
T Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (347)
T d2ivda1          70 LNLEGRIRAADPAAKRRYVYTRGRLRSVPASPPAFLASDILPLGARLRVAGELFSRRAPEGVDESLAAFGRRHLGHRATQ  149 (347)
T ss_dssp             TTCGGGEECSCSSCCCEEEEETTEEEECCCSHHHHHTCSSSCHHHHHHHHGGGGCCCCCTTCCCBHHHHHHHHTCHHHHH
T ss_pred             hcccccceeccccccceeeeccccccccccchhhhhhhhhccchhhHHHHhhhhhhhccccccccHHHHHHhhhhcchhc
Confidence            10000                                  0             00000000                   


Q ss_pred             ---------------cc---------c-------cc----------------------cCCCcceEEcCCChHHHHHHHH
Q psy12489         95 ---------------IG---------Y-------KS----------------------RKKNVTHYVTPQGSSSIVKYFL  121 (365)
Q Consensus        95 ---------------~~---------~-------~~----------------------~~~~~~~~~~~~g~~~l~~~l~  121 (365)
                                     ..         +       ..                      .......+...+|+..+++.+.
T Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~l~  229 (347)
T d2ivda1         150 VLLDAVQTGIYAGDVEQLSVAATFPMLVKMEREHRSLILGAIRAQKAQRQAALPAGTAPKLSGALSTFDGGLQVLIDALA  229 (347)
T ss_dssp             HTHHHHHHHHHCCCTTTBBHHHHCHHHHHHHHHHSSHHHHHHHHHHHHTCC----CCSCCCCCCEEEETTCTHHHHHHHH
T ss_pred             cccchhhhhhhccccchhhHHHHHHHHHHhhhhccchhhhhhhccchhccccccccccccccCcccccCCchHHHHHHHH
Confidence                           00         0       00                      0112334556789999999999


Q ss_pred             hhCCCceEEEeeeeEEeeecCCCCcEEEEecC-C--CeeecCEEEEcCChhhHHHhhcccc
Q psy12489        122 NKSNIDEICYNTFLETMAKTDSTNQIEVTSKE-G--KKGIFDIVVLSMPAPQVTDLFNRSE  179 (365)
Q Consensus       122 ~~~g~~~i~~~~~V~~i~~~~~~~~~~v~~~~-g--~~~~~d~vV~a~p~~~~~~ll~~~~  179 (365)
                      +.+| ++|++|++|++|+.++  +++.+.+.+ +  +++.||+||+|+|+..+.+||.+..
T Consensus       230 ~~~g-~~i~~~~~V~~I~~~~--~~~~v~~~~~~~~~~~~ad~VV~a~p~~~~~~Ll~~~~  287 (347)
T d2ivda1         230 ASLG-DAAHVGARVEGLARED--GGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLD  287 (347)
T ss_dssp             HHHG-GGEESSEEEEEEECC----CCEEEEEETTEEEEEECSEEEECSCHHHHHHHHTTTC
T ss_pred             HHhh-cccccCCEEEEEEEeC--CeEEEEEEcCCeEEEEECCEEEECCCHHHHHHhccCCC
Confidence            9888 9999999999999887  776665543 3  3688999999999999999887654



>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure