Diaphorina citri psyllid: psy124


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MIPSGTPNILIPIIVIIEITRNIIRPIALAVRLTANLLASLVWLGDLKQRLDQLNLAGGL
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*IPSGTPNILIPIIVIIEITRNIIRPIALAVRLTANLLASLVWLGDLKQRLDQLNLAGG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPSGTPNILIPIIVIIEITRNIIRPIALAVRLTANLLASLVWLGDLKQRLDQLNLAGGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit a Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.confidentA9M8F8
ATP synthase subunit a Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.confidentQ57EY0
ATP synthase subunit a Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.confidentB9JA28

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1C17, chain M
Confidence level:very confident
Coverage over the Query: 21-50
View the alignment between query and template
View the model in PyMOL