Diaphorina citri psyllid: psy1250


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MIFCTKRAGRRGNVQSSKRRAARPYINTKQSFKVSLDSRVREIVNRNMVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQLAQLDSSPGDTGGNSDSSTPARKSSNAT
ccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHcccccccccccccccccccccccc
MIFCTK*AG******SS**RAARPYINTKQSFKVSLDSRVREIVNRNMVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFCTKRAGRRGNVQSSKRRAARPYINTKQSFKVSLDSRVREIVNRNMVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQLAQLDSSPGDTGGNSDSSTPARKSSNAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of G-protein signaling 20 Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.confidentQ9PWA1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005096 [MF]GTPase activator activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0008047, GO:0003674
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005903 [CC]brush borderprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044445 [CC]cytosolic partprobableGO:0005737, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0038032 [BP]termination of G-protein coupled receptor signaling pathwayprobableGO:0009968, GO:0023021, GO:0048585, GO:0023051, GO:0048583, GO:0045744, GO:0050794, GO:0008150, GO:0023057, GO:0008277, GO:0065007, GO:0010648, GO:0009966, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CMZ, chain A
Confidence level:very confident
Coverage over the Query: 6-85
View the alignment between query and template
View the model in PyMOL