Diaphorina citri psyllid: psy12529

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------4

MRRVLRKVAVNDREVGDKSTLADEDVVDELFQNRPEGNV

cHHHHHHHHccccccccccccccHHHHHHHHHccccccc

MRRVLRKVAVNDREVGDKSTLADEDVVDELFQNRP****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRRVLRKVAVNDREVGDKSTLADEDVVDELFQNRPEGNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Acetyl-coenzyme A synthetase		confident	A6UED8
Acetyl-coenzyme A synthetase		confident	Q0AAW0
Acetyl-coenzyme A synthetase		confident	Q15YI8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003987 [MF]	acetate-CoA ligase activity	probable	GO:0016878, GO:0016405, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0019413 [BP]	acetate biosynthetic process	probable	GO:0071704, GO:1901576, GO:0044710, GO:0044711, GO:0006082, GO:0006083, GO:0046394, GO:0044237, GO:0009987, GO:0016053, GO:0019752, GO:0032787, GO:0044249, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283, GO:0043436, GO:0072330
GO:0048149 [BP]	behavioral response to ethanol	probable	GO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0019542 [BP]	propionate biosynthetic process	probable	GO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0019541, GO:0071704, GO:0051790, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0046459
GO:0006085 [BP]	acetyl-CoA biosynthetic process	probable	GO:0006084, GO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0044249, GO:0009058, GO:0009108, GO:0071616, GO:0008152, GO:0006793, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PG4, chain A
Confidence level:very confident
Coverage over the Query: 1-34
View the alignment between query and template
View the model in PyMOL