Diaphorina citri psyllid: psy12530


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MLNEASLHFSASGTLMFKTFHFHISTALILKQCHLVLIQKENKRRRKEGEEDKEEGGGGGGKRKKKKKKKKEKSWIRPCYLREGCTALLVAVVSRKMELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNAGRLKNAAANVLRETWLIYKHTRLVKRVNAGRVRTHQRKFLLAIY
ccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHEEHHHHHHHcccccccccccccccccHHHHHHHccccCECccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHc
*******HFSASGTLMFKTFHFHISTALILKQCHLVLIQ***********************************WIRPCYLREGCTALLVAVVSRKMELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNAGRLKNAAANVLRETWLIYKHTRLVKRVNAGRVRTHQRKFLLAIY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNEASLHFSASGTLMFKTFHFHISTALILKQCHLVLIQKENKRRRKEGEEDKEEGGGGGGKRKKKKKKKKEKSWIRPCYLREGCTALLVAVVSRKMELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNAGRLKNAAANVLRETWLIYKHTRLVKRVNAGRVRTHQRKFLLAIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small conductance calcium-activated potassium channel protein 3 Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.confidentQ9UGI6
Small conductance calcium-activated potassium channel protein 1 Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.confidentQ9EQR3
Small conductance calcium-activated potassium channel protein 1 Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.confidentP70606

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016057 [BP]regulation of membrane potential in photoreceptor cellprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0009881 [MF]photoreceptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0006816 [BP]calcium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0015269 [MF]calcium-activated potassium channel activityprobableGO:0022891, GO:0022890, GO:0005267, GO:0022892, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0022857, GO:0005227, GO:0015075, GO:0015077, GO:0015267, GO:0003674, GO:0022836, GO:0022803, GO:0022839, GO:0022838, GO:0015079, GO:0046873
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030322 [BP]stabilization of membrane potentialprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0050862 [BP]positive regulation of T cell receptor signaling pathwayprobableGO:0050854, GO:0050856, GO:0050857, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0002684, GO:0002682, GO:0008150, GO:0023051, GO:0048518, GO:0065007, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G4Y, chain B
Confidence level:very confident
Coverage over the Query: 112-137,167-189
View the alignment between query and template
View the model in PyMOL
Template: 1G4Y, chain B
Confidence level:confident
Coverage over the Query: 141-163
View the alignment between query and template
View the model in PyMOL