Diaphorina citri psyllid: psy12535

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

MGPILAPMGPGHPDPNSRRVVKVCALKEDFAQLPSGDRTLVGDKGVSLSGGQRARISLARAVYKRADVYLLDDPLSAVDAHVGKHLFEDCITGLHTGVPRFDSRWGRSFFGSALGVRGALSLVRTSFLKEKTVMLITHQIQYLTHVDHVMLLEKGSVEAFGTTTQLLASGLDFTQLLDAPEEEDKAENEVDDNASGTLLHPRQSSVRVS

ccccccccccccccHHHHHHHHHHccHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHccccccEEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHcccHHHHHcccccccccccccccccccccccc

*GPILAPMGPGHPDPNSRRVVKVCALKEDFAQLPSGDRTLVGDKGVSLSGGQRARISLARAVYKRADVYLLDDPLSAVDAHVGKHLFEDCITGLHTGVPRFDSRWGRSFFGSALGVRGALSLVRTSFLKEKTVMLITHQIQYLTHVDHVMLLEKGSVEAFGTTTQLLASGLDFTQLL********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0008514 [MF]	organic anion transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674
GO:0015722 [BP]	canalicular bile acid transport	probable	GO:0015718, GO:0015721, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006855 [BP]	drug transmembrane transport	probable	GO:0015893, GO:0009987, GO:0050896, GO:0006810, GO:0042493, GO:0051179, GO:0008150, GO:0044765, GO:0044763, GO:0042221, GO:0051234, GO:0055085, GO:0044699
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0043627 [BP]	response to estrogen stimulus	probable	GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0042626 [MF]	ATPase activity, coupled to transmembrane movement of substances	probable	GO:0016787, GO:0016818, GO:0016820, GO:0042623, GO:0005215, GO:0043492, GO:0016817, GO:0003824, GO:0017111, GO:0015399, GO:0022857, GO:0003674, GO:0016887, GO:0016462, GO:0015405, GO:0022804
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0012505 [CC]	endomembrane system	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046581 [CC]	intercellular canaliculus	probable	GO:0005575, GO:0030054, GO:0005911
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0042383 [CC]	sarcolemma	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0016328 [CC]	lateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0030644 [BP]	cellular chloride ion homeostasis	probable	GO:0030320, GO:0019725, GO:0065008, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055064, GO:0030002, GO:0055081, GO:0055082, GO:0055083, GO:0044699
GO:0005887 [CC]	integral to plasma membrane	probable	GO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 13-90,124-177
View the alignment between query and template
View the model in PyMOL

Template: 2BBT, chain A
Confidence level:confident
Coverage over the Query: 8-94,128-200
View the alignment between query and template
View the model in PyMOL