Diaphorina citri psyllid: psy12537


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MRGIKRNLQRTYASWSQTKLNSTDQGRALFTLAWFHALIQERRTYIPQGWAKFYEFNDSDLNAALNILNARLSQDGMGGVKWDYIHGLLGNAIYGGRIDNAQDMKVLSSYLQFYFSSNVAKTASTPLAPGVVLPSSTNLG
cHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHcccccccccccccccccccc
*RGIKRNLQRTYASWSQTKLNSTDQGRALFTLAWFHALIQERRTYIPQGWAKFYEFNDSDLNAALNILNARLSQDGMGGVKWDYIHGLLGNAIYGGRIDNAQDMKVLSSYLQFYFSSNVAKTASTPLAPGVVLPSS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGIKRNLQRTYASWSQTKLNSTDQGRALFTLAWFHALIQERRTYIPQGWAKFYEFNDSDLNAALNILNARLSQDGMGGVKWDYIHGLLGNAIYGGRIDNAQDMKVLSSYLQFYFSSNVAKTASTPLAPGVVLPSSTNLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic dynein 2 heavy chain 1 May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. May play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.confidentQ9JJ79
Cytoplasmic dynein 2 heavy chain 1 May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. According to PubMed:8666668, it may play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.confidentQ45VK7
Cytoplasmic dynein 2 heavy chain 1 May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. May play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.confidentQ8NCM8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031512 [CC]motile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0033036 [BP]macromolecule localizationprobableGO:0008150, GO:0051179
GO:0007030 [BP]Golgi organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A very confident Alignment | Template Structure