Diaphorina citri psyllid: psy12544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MFNILRGGNSADTTPDPGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKRFDRGNCNC
cCEEccccccccccccccccccccccHHHHccccccEEEEEEEEccccccccccccccccccccccccEEEEccEEEECccccCEEEEEcccccEEEEEEECccccccCECccccccccccccccEEEEccEEECccccc
MFNILRGGNSADTTPDPGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKRFDRGN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNILRGGNSADTTPDPGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKGKMVKGMGGAMDLVAAPSTKVVVTMEHNTRDGGHKILPECSLPLTGKQCVDLIITEKRFDRGNCNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentQ9D0K2
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentP55809
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentB2GV06

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0032024 [BP]positive regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048518, GO:0051050, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046887, GO:0032879, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0071333 [BP]cellular response to glucose stimulusprobableGO:0042592, GO:0042593, GO:0070887, GO:0048878, GO:0044699, GO:0051716, GO:0033500, GO:0071310, GO:0065007, GO:0071331, GO:0065008, GO:0019725, GO:1901700, GO:0009987, GO:0044763, GO:0001678, GO:0042221, GO:0055082, GO:0010033, GO:0009746, GO:1901701, GO:0009743, GO:0034284, GO:0071322, GO:0050896, GO:0071326, GO:0009749, GO:0008150
GO:0014823 [BP]response to activityprobableGO:0050896, GO:0008150
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0031514 [CC]motile ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0060612 [BP]adipose tissue developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0071229 [BP]cellular response to acidprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0001101, GO:0070887, GO:0042221, GO:0044699
GO:0042594 [BP]response to starvationprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150
GO:0006091 [BP]generation of precursor metabolites and energyprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0046952 [BP]ketone body catabolic processprobableGO:0044712, GO:0044710, GO:0008152, GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0044281, GO:0044282, GO:0009056, GO:0046950
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0008260 [MF]3-oxoacid CoA-transferase activityprobableGO:0008410, GO:0016740, GO:0016782, GO:0003674, GO:0003824
GO:0042182 [BP]ketone catabolic processprobableGO:0044712, GO:1901575, GO:0042180, GO:0009987, GO:0044710, GO:0044237, GO:0044248, GO:0071704, GO:0008152, GO:0008150, GO:0044281, GO:0044282, GO:0009056

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RRL, chain B
Confidence level:very confident
Coverage over the Query: 1-92
View the alignment between query and template
View the model in PyMOL
Template: 3RRL, chain B
Confidence level:very confident
Coverage over the Query: 66-134
View the alignment between query and template
View the model in PyMOL