Diaphorina citri psyllid: psy12547


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
KRTNHWPLLGSPIPGLTIIGLYLYFILSYGPRFMANRKPLNLRYVLIVYNFFQVGISVWLVWEAMDAAWTHYSWKCEPVDFSNSPSAMRIAWGVYIYFLAKISELLDTVFFVLRKKHNQITFLHMYHHTVMPMVSWGAAKYYPGGHGTFIGTINSFVHVIMYTYYALAALGDQLSTCKNPQ
ccccccccccccHHHHHHHHHHHHHHHHHcHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEECccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccEEEEEEccccHHHHHHHcEEECcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
KRTNHWPLLGSPIPGLTIIGLYLYFILSYGPRFMANRKPLNLRYVLIVYNFFQVGISVWLVWEAMDAAWTHYSWKCEPVDFSNSPSAMRIAWGVYIYFLAKISELLDTVFFVLRKKHNQITFLHMYHHTVMPMVSWGAAKYYPGGHGTFIGTINSFVHVIMYTYYALAALGDQLSTCK***
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KRTNHWPLLGSPIPGLTIIGLYLYFILSYGPRFMANRKPLNLRYVLIVYNFFQVGISVWLVWEAMDAAWTHYSWKCEPVDFSNSPSAMRIAWGVYIYFLAKISELLDTVFFVLRKKHNQITFLHMYHHTVMPMVSWGAAKYYPGGHGTFIGTINSFVHVIMYTYYALAALGDQLSTCKNPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation of very long chain fatty acids protein 1 Involved in the biosynthesis of C26 fatty acids and sphingolipids. Condensing enzyme that catalyzes the synthesis of both saturated and monounsaturated very long chain fatty acids. Exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Important for sphingolipid biosynthesis.confidentQ9JLJ5
Elongation of very long chain fatty acids protein 7 Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.confidentA0JNC4
Elongation of very long chain fatty acids protein 7 Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2-and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs.confidentA1L3X0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042761 [BP]very long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0009922 [MF]fatty acid elongase activityprobableGO:0004312, GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0034625 [BP]fatty acid elongation, monounsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368
GO:0019367 [BP]fatty acid elongation, saturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237
GO:0019432 [BP]triglyceride biosynthetic processprobableGO:0071704, GO:0045017, GO:0044710, GO:0044238, GO:0006629, GO:0006641, GO:0009987, GO:0006639, GO:0006638, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:1901576, GO:0046486, GO:0044255, GO:0046463, GO:0046460, GO:0008610
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0030148 [BP]sphingolipid biosynthetic processprobableGO:1901576, GO:0006629, GO:0044238, GO:1901564, GO:0006643, GO:1901566, GO:0071704, GO:0009987, GO:0044710, GO:0044237, GO:0044249, GO:0009058, GO:0006807, GO:0008150, GO:0008152, GO:0046467, GO:0044255, GO:0006665, GO:0008610
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0035338 [BP]long-chain fatty-acyl-CoA biosynthetic processprobableGO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0008150, GO:0044249, GO:0009058, GO:0046949, GO:0071616, GO:0008152, GO:0006793, GO:0009108, GO:0035336, GO:0035337
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0034626 [BP]fatty acid elongation, polyunsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted