Diaphorina citri psyllid: psy12551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
CKCSSKSGLTYIPVVLRQSQVNPSRLPVVVGGLLDVDCSEDIIKNLILVVRGQFSTDELVEEDKIP
ccccccccccEEEEEEEEcccccccccHHHHHHHcccccHHHHHHHHHHHccccccHHHHHccccc
********LTYIPVVLRQSQVNPSRLPVVVGGLLDVDCSEDIIKNLILVVRGQFSTDELVE*D***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CKCSSKSGLTYIPVVLRQSQVNPSRLPVVVGGLLDVDCSEDIIKNLILVVRGQFSTDELVEEDKIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Clathrin heavy chain 1 Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network.confidentP11442
Clathrin heavy chain 1 Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network.confidentQ00610
Clathrin heavy chain Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.confidentP29742

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031072 [MF]heat shock protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0033572 [BP]transferrin transportprobableGO:0045184, GO:0033036, GO:0000041, GO:0072512, GO:0006812, GO:0006811, GO:0006810, GO:0015682, GO:0044765, GO:0008104, GO:0006826, GO:0008150, GO:0071702, GO:0015031, GO:0030001, GO:0051234, GO:0051179, GO:0044699
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030665 [CC]clathrin-coated vesicle membraneprobableGO:0043229, GO:0030135, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0031623 [BP]receptor internalizationprobableGO:0051234, GO:0006898, GO:0006897, GO:0016192, GO:0044260, GO:0006810, GO:0044237, GO:0043170, GO:0071704, GO:0044765, GO:0008150, GO:0008152, GO:0009987, GO:0043112, GO:0051179, GO:0044699
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030117 [CC]membrane coatprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0048475
GO:0030506 [MF]ankyrin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0045334 [CC]clathrin-coated endocytic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0005575, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005905 [CC]coated pitprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XI4, chain A
Confidence level:very confident
Coverage over the Query: 5-65
View the alignment between query and template
View the model in PyMOL