Diaphorina citri psyllid: psy12553

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-
MEEIHTASNVTEVESCIRSNDNSRNLIISSTIPESCKSQPCVLGIDEAGRGPVLGPMVYGTAYCPKDNNEELLKNLGCADSKALTEKKRDDILDSICKENAWLGWMVEIISPNVICNSMLRRQKYSLNEVSHDAAIGLIRKVIAAGVNVREVYVDTVGPPESYKKKLSEIFPELIITVASKADSTYPVVGAAIASKADSTYPVVGAASICAKVSRDSALKSWTFQEGIQIENNAWGSGYPGDPVTKKFLSENIDPVFGFPQLVRFSWSTASKILKEKAVLVEGDEIDDEEEEGENKKTRSIRNFFKPKADENVESPVVEERHAFFKESPYGGSKVFEVLNSTYLNILEMAHFIGKKLNLTSIDLLFYIPLLTRNLEVKLKSKFFKLGEELKHQLIFFLGLR
cccccccccccccccccccccccccEEECcccccccccccEEEcccccccccccccEEEEEEECcccccHHHHHcccccccccccHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccccEEEEccccccccccccEEEECccccccccEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEHHHHHcccccHHHHHHHHHHHHHHHHHHHEEEcccc
*************************LIISSTIPESCKSQPCVLGIDEAGRGPVLGPMVYGTAYCPKDNNEELLKNLGCADSKALTEKKRDDILDSICKENAWLGWMVEIISPNVICNSMLRRQKYSLNEVSHDAAIGLIRKVIAAGVNVREVYVDTVGPPESYKKKLSEIFPELIITVASKADSTYPVVGAAIASKADSTYPVVGAASICAKVSRDSALKSWTFQEGIQIENNAWGSGYPGDPVTKKFLSENIDPVFGFPQLVRFSWSTASKILKEKAVLVEGDE************************************HAFFKESPYGGSKVFEVLNSTYLNILEMAHFIGKKLNLTSIDLLFYIPLLTRNLEVKLKSKFFKLGEELKHQLIFFLGLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEIHTASNVTEVESCIRSNDNSRNLIISSTIPESCKSQPCVLGIDEAGRGPVLGPMVYGTAYCPKDNNEELLKNLGCADSKALTEKKRDDILDSICKENAWLGWMVEIISPNVICNSMLRRQKYSLNEVSHDAAIGLIRKVIAAGVNVREVYVDTVGPPESYKKKLSEIFPELIITVASKADSTYPVVGAAIASKADSTYPVVGAASICAKVSRDSALKSWTFQEGIQIENNAWGSGYPGDPVTKKFLSENIDPVFGFPQLVRFSWSTASKILKEKAVLVEGDEIDDEEEEGENKKTRSIRNFFKPKADENVESPVVEERHAFFKESPYGGSKVFEVLNSTYLNILEMAHFIGKKLNLTSIDLLFYIPLLTRNLEVKLKSKFFKLGEELKHQLIFFLGLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonuclease H2 subunit A Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.confidentQ9VPP5
Ribonuclease H2 subunit A Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.confidentQ5U209
Ribonuclease H2 subunit A Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.confidentQ9SEZ6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004523 [MF]ribonuclease H activityprobableGO:0016787, GO:0003824, GO:0004518, GO:0004519, GO:0004540, GO:0004521, GO:0016788, GO:0016893, GO:0016891, GO:0003674
GO:0006401 [BP]RNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0032299 [CC]ribonuclease H2 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.26.-Endoribonucleases producing 5'-phosphomonoesters.probable
3.1.26.4Ribonuclease H.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KIO, chain A
Confidence level:very confident
Coverage over the Query: 12-185,201-286
View the alignment between query and template
View the model in PyMOL