Diaphorina citri psyllid: psy12571

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MCIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHTSSLLKKFSIVSSIHWSTKYASDLQARGIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHTSSLLKK
cccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHccccccccccccHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
MCIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHTSSLLKKFSIVSSIHWSTKYASDLQARGIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHT******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHTSSLLKKFSIVSSIHWSTKYASDLQARGIAMCKSLSGLTKTQLDLCYKHPEVTSVALRGLRLAVEECQHQFHKNRWNCSSLITKNSNPHTSSLLKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048639 [BP]positive regulation of developmental growthprobableGO:0048638, GO:0045927, GO:0051094, GO:0050793, GO:0040008, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:2000027 [BP]regulation of organ morphogenesisprobableGO:0022603, GO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0051240 [BP]positive regulation of multicellular organismal processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030097 [BP]hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0048585 [BP]negative regulation of response to stimulusprobableGO:0008150, GO:0048519, GO:0065007, GO:0048583, GO:0050789
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F0A, chain B
Confidence level:very confident
Coverage over the Query: 22-88
View the alignment between query and template
View the model in PyMOL
Template: 4F0A, chain B
Confidence level:very confident
Coverage over the Query: 111-144
View the alignment between query and template
View the model in PyMOL