Diaphorina citri psyllid: psy12576


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MKSDIDEVALQGIEFWSNVSDEEVDLAIEDSEAADFGRPPTRTSRFYAKGALQYLVPILTQKLTKQEELDDEDDWNPCKAAGVCLMLLSSCCEEDMVPHILPFVNANIEHADWRHRDAALMSFGAILVRPSFIITISERNFIMEVVCEATQSPDTQIRVAALQCL
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHcc
***DIDEVALQGIEFWSNVSDEEVDLAIEDS************SRFYAKGALQYLVPILTQKLTKQEELDDEDDWNPCKAAGVCLMLLSSCCEEDMVPHILPFVNANIEHADWRHRDAALMSFGAILVRPSFIITISERNFIMEVVCEATQSPDTQIRVAALQCL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSDIDEVALQGIEFWSNVSDEEVDLAIEDSEAADFGRPPTRTSRFYAKGALQYLVPILTQKLTKQEELDDEDDWNPCKAAGVCLMLLSSCCEEDMVPHILPFVNANIEHADWRHRDAALMSFGAILVRPSFIITISERNFIMEVVCEATQSPDTQIRVAALQCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin subunit beta-1 Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports PRKCI into the nucleus.confidentP52296
Importin subunit beta-1 Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports PRKCI into the nucleus.confidentQ14974
Importin subunit beta-1 Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports PRKCI into the nucleus.confidentP70168

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005575 [CC]cellular_componentconfident
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006610 [BP]ribosomal protein import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0051641, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0006309 [BP]apoptotic DNA fragmentationprobableGO:0006921, GO:0097194, GO:0090304, GO:0090305, GO:0034641, GO:0030262, GO:0007569, GO:0044699, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071840, GO:0016043, GO:0006308, GO:0008150, GO:0071704, GO:1901360, GO:0010259, GO:0009987, GO:0044238, GO:0006915, GO:0006725, GO:0046700, GO:0006259, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0012501, GO:0000737, GO:0044237, GO:0043170, GO:0006807, GO:0019439, GO:0022411
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000059 [BP]protein import into nucleus, dockingprobableGO:0034504, GO:0051169, GO:0022607, GO:0070271, GO:0043933, GO:0008104, GO:0051641, GO:0034622, GO:0044699, GO:0071822, GO:0070727, GO:0006886, GO:0016043, GO:0065003, GO:0071840, GO:0006810, GO:0071702, GO:0033036, GO:0034613, GO:0017038, GO:0006461, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0043623, GO:0051179, GO:0016482, GO:0046907, GO:0044763, GO:0044085, GO:0033365, GO:0008150, GO:0009987
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005643 [CC]nuclear poreprobableGO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0008139 [MF]nuclear localization sequence bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005048, GO:0005488
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000060 [BP]protein import into nucleus, translocationprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0006810, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0019058 [BP]viral infectious cycleprobableGO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0051704
GO:0006607 [BP]NLS-bearing substrate import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0051641, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BPT, chain A
Confidence level:very confident
Coverage over the Query: 2-165
View the alignment between query and template
View the model in PyMOL