Diaphorina citri psyllid: psy12580

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24

MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL

cccccccccccccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccCEEEccccccEEEEEECcccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEECccccCEEEEEEcccccHHHHHHccccccccHHHHHHHHHHHHHHHcHHHcccccccccccccccEEEEcc

*YYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQ***********************DATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004672 [MF]	protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0030016 [CC]	myofibril	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0030054 [CC]	cell junction	probable	GO:0005575
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044449 [CC]	contractile fiber part	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0044699 [BP]	single-organism process	probable	GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 3-95
View the alignment between query and template
View the model in PyMOL

Template: 3EU9, chain A
Confidence level:very confident
Coverage over the Query: 2-133
View the alignment between query and template
View the model in PyMOL

Template: 3KMU, chain A
Confidence level:very confident
Coverage over the Query: 96-235
View the alignment between query and template
View the model in PyMOL