Psyllid ID: psy12580


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
cccccccccccccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEEcccccHHHHHHccccccccHHHHHHHHHHHHHHHcHHHcccccccccccccccEEEEcc
cEEccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccHHHccccHHHcccccEEccccccEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccEEEcccccccEEEEcc
myyvsvtddhgfsplhwackEGHLKLVELLLQRGarvnatnrgddtplhLAAAHGHLDIVRLLAVQnnqdltkinfkdqswlglktrsrdatlsrhkgislndlslhtkissgpngdtwrgrwqkNDIVAKILAvrnctprvsrdfneefpklrifshpnvlpvigcvnsppdlVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
MYYVSVtddhgfspLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQdltkinfkdqswlglktrsrdatlsrhkgislndlslhtkissgpngdtwrgrWQKNDIVAKIlavrnctprvsrDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLEriipqyqlnsrhVMVYIL
MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
**YVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTR**********GISLNDLSLHTKI****NGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYI*
*YYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAH***********************************DATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQ*********************SRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVYIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
Q13418 452 Integrin-linked protein k yes N/A 0.958 0.506 0.437 4e-62
Q5R5V4 452 Integrin-linked protein k yes N/A 0.958 0.506 0.437 4e-62
P57044 451 Integrin-linked protein k yes N/A 0.958 0.507 0.434 1e-61
Q3SWY2 452 Integrin-linked protein k yes N/A 0.958 0.506 0.434 2e-61
Q99J82 452 Integrin-linked protein k yes N/A 0.958 0.506 0.430 3e-61
O55222 452 Integrin-linked protein k yes N/A 0.958 0.506 0.430 3e-61
Q59H18 835 Serine/threonine-protein no N/A 0.941 0.269 0.326 3e-23
Q5GIG6 834 Serine/threonine-protein no N/A 0.941 0.269 0.323 5e-22
Q7TQP6 835 Serine/threonine-protein no N/A 0.941 0.269 0.319 1e-21
Q5RF15618 Serine/threonine-protein no N/A 0.912 0.352 0.332 2e-21
>sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 Back     alignment and function desciption
 Score =  238 bits (606), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 173/297 (58%), Gaps = 68/297 (22%)

Query: 8   DDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDT--------------------- 46
           DDHGFSPLHWAC+EG   +VE+L+ RGAR+N  NRGDDT                     
Sbjct: 31  DDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYK 90

Query: 47  ------------PLHLAA------------AHGHL--------------------DIVRL 62
                       PLH A             A+G L                    +++R 
Sbjct: 91  ADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRE 150

Query: 63  LAVQNNQDLTKINFKDQSWLGL-KTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRG 121
            A +  Q+L +I +KD  W G  +TR R+ TL++H GI    L+  TK++   +G+ W+G
Sbjct: 151 RAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG 210

Query: 122 RWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSP--PDLVVISQ 179
           RWQ NDIV K+L VR+ + R SRDFNEE P+LRIFSHPNVLPV+G   SP  P   +I+ 
Sbjct: 211 RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITH 270

Query: 180 YMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMV 236
           +M +GSLY +LHEG   VVD +QA++FA+D+ARGMAFLH+LE +IP++ LNSR VM+
Sbjct: 271 WMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMI 327




Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 Back     alignment and function description
>sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 Back     alignment and function description
>sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 Back     alignment and function description
>sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 Back     alignment and function description
>sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 Back     alignment and function description
>sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 Back     alignment and function description
>sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 Back     alignment and function description
>sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 Back     alignment and function description
>sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
242023921 448 Integrin-linked protein kinase, putative 0.958 0.511 0.622 3e-96
193639989 448 PREDICTED: integrin-linked protein kinas 0.958 0.511 0.608 8e-95
170062766 448 integrin-linked protein kinase [Culex qu 0.958 0.511 0.585 1e-86
357621622 473 putative integrin-linked protein kinase 0.966 0.488 0.561 2e-86
157130008 448 integrin-linked protein kinase 2 (ilk-2) 0.958 0.511 0.585 5e-86
262305469305 protein kinase [Acheta domesticus] 0.870 0.681 0.741 5e-86
91079909 448 PREDICTED: similar to integrin-linked pr 0.958 0.511 0.574 2e-85
289740545 448 integrin-linked kinase [Glossina morsita 0.974 0.520 0.560 8e-85
195126621 453 GI13131 [Drosophila mojavensis] gi|19391 0.974 0.514 0.557 9e-85
195379018 453 GJ13879 [Drosophila virilis] gi|19415543 0.974 0.514 0.553 1e-84
>gi|242023921|ref|XP_002432379.1| Integrin-linked protein kinase, putative [Pediculus humanus corporis] gi|212517802|gb|EEB19641.1| Integrin-linked protein kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 204/294 (69%), Gaps = 65/294 (22%)

Query: 8   DDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDD---------------------- 45
           DDHG SPLHWA KEGH K+VELLLQRGARVNATNRGDD                      
Sbjct: 31  DDHGLSPLHWASKEGHAKIVELLLQRGARVNATNRGDDTALHLAAAHGHREIVHMLLKSR 90

Query: 46  -----------TPLHLAA-------------------------------AHGHL-DIVRL 62
                      +PLH A                                A GHL   +  
Sbjct: 91  ADVNFINEHGNSPLHYACFWGYQGIAEDLVAQGGLVSLANKDGDTPLDKARGHLAKTLHD 150

Query: 63  LAVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGR 122
           LAV+  QDL KI FKDQSWLGLKTRSRD TLSRH+GI++ DL+LHTKI+S P+GDTWRG+
Sbjct: 151 LAVETGQDLKKITFKDQSWLGLKTRSRDPTLSRHRGINIADLALHTKIASTPSGDTWRGK 210

Query: 123 WQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMA 182
           WQKND+VAKILAVR CTPR+SRDFNEEFPKLRIFSHPNVLPVIGC NSPP+LVVI+QYM 
Sbjct: 211 WQKNDVVAKILAVRECTPRISRDFNEEFPKLRIFSHPNVLPVIGCCNSPPNLVVINQYMP 270

Query: 183 WGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMV 236
           WGSLY LLHEGAG+VVD AQALRFAVD ARGMA+LHSLER+ PQ+ LNSRH+M+
Sbjct: 271 WGSLYTLLHEGAGVVVDMAQALRFAVDTARGMAYLHSLERLNPQFNLNSRHIMI 324




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193639989|ref|XP_001947936.1| PREDICTED: integrin-linked protein kinase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170062766|ref|XP_001866812.1| integrin-linked protein kinase [Culex quinquefasciatus] gi|167880577|gb|EDS43960.1| integrin-linked protein kinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357621622|gb|EHJ73397.1| putative integrin-linked protein kinase [Danaus plexippus] Back     alignment and taxonomy information
>gi|157130008|ref|XP_001655514.1| integrin-linked protein kinase 2 (ilk-2) [Aedes aegypti] gi|108884397|gb|EAT48622.1| AAEL000378-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|262305469|gb|ACY45327.1| protein kinase [Acheta domesticus] Back     alignment and taxonomy information
>gi|91079909|ref|XP_966719.1| PREDICTED: similar to integrin-linked protein kinase 2 (ilk-2) [Tribolium castaneum] gi|270003268|gb|EEZ99715.1| hypothetical protein TcasGA2_TC002476 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|289740545|gb|ADD19020.1| integrin-linked kinase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195126621|ref|XP_002007769.1| GI13131 [Drosophila mojavensis] gi|193919378|gb|EDW18245.1| GI13131 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195379018|ref|XP_002048278.1| GJ13879 [Drosophila virilis] gi|194155436|gb|EDW70620.1| GJ13879 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
FB|FBgn0028427 448 Ilk "Integrin linked kinase" [ 0.970 0.517 0.618 1.1e-73
UNIPROTKB|B7Z418 391 ILK "cDNA FLJ50979, moderately 0.949 0.580 0.525 3.1e-60
WB|WBGene00003931 466 pat-4 [Caenorhabditis elegans 0.974 0.5 0.472 4e-58
UNIPROTKB|Q9TZC4 466 pat-4 "Protein PAT-4" [Caenorh 0.974 0.5 0.472 4e-58
UNIPROTKB|F1NP98 422 ILK "Uncharacterized protein" 0.970 0.549 0.495 5.9e-57
UNIPROTKB|Q13418 452 ILK "Integrin-linked protein k 0.970 0.513 0.474 2.6e-54
UNIPROTKB|I3L9C8 452 ILK "Uncharacterized protein" 0.970 0.513 0.474 4.3e-54
UNIPROTKB|E2R5H4 452 ILK "Uncharacterized protein" 0.970 0.513 0.470 8.9e-54
MGI|MGI:1195267 452 Ilk "integrin linked kinase" [ 0.970 0.513 0.466 1.9e-53
RGD|620063 452 Ilk "integrin-linked kinase" [ 0.970 0.513 0.466 1.9e-53
FB|FBgn0028427 Ilk "Integrin linked kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 744 (267.0 bits), Expect = 1.1e-73, P = 1.1e-73
 Identities = 144/233 (61%), Positives = 179/233 (76%)

Query:     4 VSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLL 63
             V+  ++HG +PLH+AC  G+  + E LL  GA+V   N+   TPL  A        ++ L
Sbjct:    93 VNAVNEHGNTPLHYACFWGYDMICEDLLNAGAQVGIANKDGHTPLEKAKP-SLAKRLQDL 151

Query:    64 AVQNNQDLTKINFKDQSWLGLKTRSRDATLSRHKGISLNDLSLHTKISSGPNGDTWRGRW 123
               ++ +++  I+FK+QSW GLKTRSRDATLSR KGIS+ DL LHTK+S  P+G+TWRGRW
Sbjct:   152 VEKSGREVKVISFKEQSWQGLKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRW 211

Query:   124 QKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVVISQYMAW 183
             QKND+VAKILAVR CTPR+SRDFNEEFPKLRIFSHPN+LP+IG  NSPP+LV ISQ+M  
Sbjct:   212 QKNDVVAKILAVRQCTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPR 271

Query:   184 GSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMV 236
              SL++LLH   G+VVD +QA+ FA+DVARGMAFLHSLERIIP Y LNS HVM+
Sbjct:   272 LSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLERIIPTYHLNSHHVMI 324


GO:0007229 "integrin-mediated signaling pathway" evidence=ISS;IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005925 "focal adhesion" evidence=ISS
GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IKR;NAS
GO:0004672 "protein kinase activity" evidence=IKR;NAS
GO:0016203 "muscle attachment" evidence=IMP
GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0007160 "cell-matrix adhesion" evidence=IMP
GO:0007155 "cell adhesion" evidence=TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0009966 "regulation of signal transduction" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|B7Z418 ILK "cDNA FLJ50979, moderately similar to Integrin-linked protein kinase (EC 2.7.11.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00003931 pat-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TZC4 pat-4 "Protein PAT-4" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP98 ILK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q13418 ILK "Integrin-linked protein kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9C8 ILK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5H4 ILK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1195267 Ilk "integrin linked kinase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620063 Ilk "integrin-linked kinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-17
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 2e-16
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 6e-16
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-15
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-14
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-14
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-12
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 4e-12
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 4e-11
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 9e-11
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-10
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-10
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 6e-10
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 8e-10
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-09
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-09
cd05069 260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-09
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 4e-09
cd05070 260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 5e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-08
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 9e-08
cd05071 262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-07
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 4e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-07
cd05083 254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-06
smart0024830 smart00248, ANK, ankyrin repeats 2e-06
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-06
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-06
cd05067 260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-06
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 3e-06
cd05072 261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 4e-06
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 5e-06
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 6e-06
cd05043 280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 8e-06
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-05
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 2e-05
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-05
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 3e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-05
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 4e-05
cd05113 256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 4e-05
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 6e-05
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 6e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 1e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-04
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-04
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-04
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 2e-04
cd05073 260 cd05073, PTKc_Hck, Catalytic domain of the Protein 2e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-04
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 3e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 7e-04
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 8e-04
cd05047 270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 8e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.001
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.001
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 0.001
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.001
cd08216 314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 0.001
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 0.001
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 0.001
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 0.002
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.002
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.003
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 0.003
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.004
cd05064 266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 81.7 bits (202), Expect = 7e-20
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 6  VTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAV 65
            D+ G +PLH A   GHL++V+LLL+ GA VNA +    TPLHLAA +GHL+IV+LL +
Sbjct: 2  ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLL-L 60

Query: 66 QNNQDLTKINFKDQS 80
          +   D+   +    +
Sbjct: 61 EKGADVNARDKDGNT 75


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
KOG0195|consensus 448 100.0
KOG0595|consensus 429 100.0
KOG0192|consensus 362 100.0
KOG1187|consensus 361 99.97
KOG0615|consensus 475 99.97
KOG0197|consensus 468 99.97
KOG0581|consensus 364 99.97
KOG0598|consensus 357 99.96
KOG0575|consensus 592 99.96
KOG0193|consensus 678 99.96
KOG0600|consensus 560 99.96
KOG0592|consensus 604 99.96
KOG0591|consensus 375 99.96
KOG0593|consensus 396 99.96
KOG0580|consensus 281 99.96
KOG0194|consensus 474 99.95
KOG0610|consensus 459 99.95
KOG0583|consensus 370 99.95
KOG0616|consensus 355 99.95
KOG0661|consensus 538 99.95
KOG0659|consensus 318 99.95
KOG0198|consensus 313 99.95
KOG0597|consensus 808 99.95
KOG0582|consensus 516 99.95
KOG0611|consensus 668 99.95
KOG0594|consensus 323 99.95
KOG0605|consensus 550 99.95
KOG0585|consensus 576 99.94
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.94
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.94
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.94
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.94
KOG0663|consensus 419 99.94
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.94
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.94
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.94
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.94
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.94
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.94
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.94
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.93
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.93
KOG0658|consensus 364 99.93
KOG0589|consensus 426 99.93
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.93
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.93
KOG1989|consensus 738 99.93
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.93
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.93
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.93
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.93
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.93
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.93
KOG1094|consensus 807 99.93
KOG0588|consensus 786 99.93
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.93
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.93
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.93
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.93
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.93
KOG1026|consensus 774 99.93
KOG0584|consensus 632 99.93
KOG0032|consensus 382 99.93
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.93
KOG4250|consensus 732 99.93
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.93
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.93
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.93
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.93
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.93
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.93
PHA02988 283 hypothetical protein; Provisional 99.92
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.92
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.92
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.92
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.92
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.92
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.92
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.92
KOG4721|consensus 904 99.92
KOG0578|consensus 550 99.92
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.92
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.92
KOG0586|consensus 596 99.92
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.92
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.92
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.92
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.92
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.92
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.92
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.92
KOG0667|consensus 586 99.92
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.92
KOG0033|consensus 355 99.92
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.92
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.92
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.92
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.92
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.92
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.92
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.92
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.92
KOG0196|consensus 996 99.92
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.92
KOG4717|consensus 864 99.92
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.92
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.92
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.92
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.92
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.92
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.92
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.92
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.92
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.91
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.91
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.91
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.91
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.91
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.91
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.91
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.91
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.91
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.91
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.91
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.91
PHA03212 391 serine/threonine kinase US3; Provisional 99.91
KOG1095|consensus 1025 99.91
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.91
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.91
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.91
KOG0599|consensus 411 99.91
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.91
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.91
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.91
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.91
KOG0694|consensus 694 99.91
KOG0607|consensus 463 99.91
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.91
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.91
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.91
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.91
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.91
KOG2052|consensus 513 99.91
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.91
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.91
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.91
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.91
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.91
KOG0660|consensus 359 99.91
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.91
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.91
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.91
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.91
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.91
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.91
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.91
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.91
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.91
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.91
KOG0662|consensus 292 99.91
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.91
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.91
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.91
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.91
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.91
PTZ00267 478 NIMA-related protein kinase; Provisional 99.91
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.91
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.91
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.91
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.91
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.91
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.91
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.91
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.91
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.91
KOG0574|consensus 502 99.91
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.91
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.91
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.91
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.91
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.91
PTZ00283 496 serine/threonine protein kinase; Provisional 99.91
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.91
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.9
KOG3653|consensus 534 99.9
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.9
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.9
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.9
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.9
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.9
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.9
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.9
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.9
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.9
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.9
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.9
KOG2345|consensus 302 99.9
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.9
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.9
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.9
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.9
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.9
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.9
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.9
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.9
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.9
KOG4236|consensus 888 99.9
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.9
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.9
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.9
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.9
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.9
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.9
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.9
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.9
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.9
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.9
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.9
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.9
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.9
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.9
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.9
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.9
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.9
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.9
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.9
KOG4257|consensus 974 99.9
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.9
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.9
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.9
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.9
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.9
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.9
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.9
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.9
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.9
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.9
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.9
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.89
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.89
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.89
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.89
PLN00009 294 cyclin-dependent kinase A; Provisional 99.89
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.89
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.89
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.89
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.89
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.89
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.89
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.89
PTZ00036 440 glycogen synthase kinase; Provisional 99.89
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.89
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.89
KOG0666|consensus 438 99.89
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.89
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.89
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.89
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.89
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.89
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.89
PHA03211 461 serine/threonine kinase US3; Provisional 99.89
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.89
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.89
PHA03209 357 serine/threonine kinase US3; Provisional 99.89
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.89
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.89
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.89
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.89
KOG0579|consensus 1187 99.89
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.89
KOG0612|consensus 1317 99.89
PHA03207 392 serine/threonine kinase US3; Provisional 99.89
KOG0199|consensus 1039 99.89
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.89
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.88
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.88
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.88
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.88
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.88
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.88
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.88
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.88
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.88
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.88
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.88
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.88
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.88
KOG1290|consensus 590 99.88
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.88
KOG4278|consensus 1157 99.88
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.88
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.88
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.88
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.88
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.88
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.88
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.88
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.88
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.88
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.88
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.88
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.88
KOG0201|consensus 467 99.88
KOG0577|consensus 948 99.88
PRK10345210 hypothetical protein; Provisional 99.88
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.88
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.87
PTZ00284 467 protein kinase; Provisional 99.87
KOG0668|consensus 338 99.87
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.87
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.87
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.87
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.87
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.87
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.87
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.87
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.87
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.87
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.87
PHA03210 501 serine/threonine kinase US3; Provisional 99.87
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.87
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.87
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.87
KOG1035|consensus 1351 99.87
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.87
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.87
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.87
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.87
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.87
KOG4645|consensus 1509 99.87
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.86
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.86
PRK09188 365 serine/threonine protein kinase; Provisional 99.86
KOG1151|consensus 775 99.86
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.86
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.86
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.86
KOG1152|consensus772 99.86
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.86
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.86
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.86
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.86
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.86
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.86
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.86
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.86
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.86
KOG0604|consensus 400 99.86
KOG1025|consensus 1177 99.86
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.86
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.86
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.86
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.86
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.86
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.86
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.86
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.86
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.85
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.85
KOG4279|consensus 1226 99.85
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.85
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.85
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.85
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.85
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.85
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.85
KOG0596|consensus 677 99.85
KOG4412|consensus226 99.85
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.85
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.85
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.85
KOG0986|consensus 591 99.84
KOG0608|consensus 1034 99.84
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.84
KOG0669|consensus 376 99.84
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.84
KOG0690|consensus 516 99.83
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.83
KOG1027|consensus 903 99.83
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.83
PHA02882 294 putative serine/threonine kinase; Provisional 99.83
KOG0576|consensus 829 99.82
KOG0587|consensus 953 99.82
KOG4412|consensus226 99.82
KOG1345|consensus 378 99.82
KOG1163|consensus 341 99.81
KOG0200|consensus 609 99.81
KOG0671|consensus 415 99.8
PRK14879211 serine/threonine protein kinase; Provisional 99.8
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.8
KOG0614|consensus 732 99.8
KOG0984|consensus282 99.8
KOG0664|consensus 449 99.8
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.8
KOG1006|consensus 361 99.79
KOG0983|consensus 391 99.79
KOG0696|consensus 683 99.79
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.79
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.78
KOG0695|consensus 593 99.78
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.78
KOG0512|consensus228 99.78
KOG1164|consensus 322 99.78
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.77
KOG0603|consensus 612 99.76
KOG1165|consensus 449 99.76
KOG1167|consensus 418 99.76
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 99.75
smart00090237 RIO RIO-like kinase. 99.75
KOG0509|consensus 600 99.74
PRK12274218 serine/threonine protein kinase; Provisional 99.74
PHA02743166 Viral ankyrin protein; Provisional 99.73
KOG0665|consensus 369 99.71
KOG0514|consensus452 99.71
PHA02741169 hypothetical protein; Provisional 99.71
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.7
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.68
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.68
KOG0509|consensus 600 99.68
KOG0502|consensus296 99.67
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.67
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.66
KOG1166|consensus 974 99.65
PHA02736154 Viral ankyrin protein; Provisional 99.63
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.63
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.62
KOG0670|consensus 752 99.62
KOG4214|consensus117 99.62
KOG0508|consensus 615 99.62
KOG4177|consensus 1143 99.61
PHA02884300 ankyrin repeat protein; Provisional 99.61
PHA02946 446 ankyin-like protein; Provisional 99.61
PHA02791284 ankyrin-like protein; Provisional 99.61
PHA02791284 ankyrin-like protein; Provisional 99.61
PLN03192823 Voltage-dependent potassium channel; Provisional 99.6
KOG1024|consensus 563 99.6
PHA02874434 ankyrin repeat protein; Provisional 99.6
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.59
PHA02859209 ankyrin repeat protein; Provisional 99.59
KOG0510|consensus 929 99.58
PHA02878477 ankyrin repeat protein; Provisional 99.57
PHA02859209 ankyrin repeat protein; Provisional 99.57
PHA02741169 hypothetical protein; Provisional 99.57
PHA02875413 ankyrin repeat protein; Provisional 99.56
KOG0514|consensus452 99.56
PHA03095471 ankyrin-like protein; Provisional 99.54
PHA02878477 ankyrin repeat protein; Provisional 99.53
PHA02730 672 ankyrin-like protein; Provisional 99.53
PHA02875413 ankyrin repeat protein; Provisional 99.53
PHA03095 471 ankyrin-like protein; Provisional 99.53
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.52
PHA02743166 Viral ankyrin protein; Provisional 99.52
KOG0512|consensus228 99.51
KOG0508|consensus 615 99.5
PHA02874434 ankyrin repeat protein; Provisional 99.5
PHA02798 489 ankyrin-like protein; Provisional 99.5
PHA02795437 ankyrin-like protein; Provisional 99.49
PHA03100480 ankyrin repeat protein; Provisional 99.47
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.47
PHA02884300 ankyrin repeat protein; Provisional 99.46
PHA02946446 ankyin-like protein; Provisional 99.46
PHA02876682 ankyrin repeat protein; Provisional 99.46
PHA02736154 Viral ankyrin protein; Provisional 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
PHA03100 480 ankyrin repeat protein; Provisional 99.45
PLN00181 793 protein SPA1-RELATED; Provisional 99.43
KOG1240|consensus 1431 99.43
PHA02798 489 ankyrin-like protein; Provisional 99.43
PHA02795437 ankyrin-like protein; Provisional 99.43
KOG0515|consensus752 99.42
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.42
PHA02989494 ankyrin repeat protein; Provisional 99.41
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.41
KOG0195|consensus 448 99.39
PHA02917 661 ankyrin-like protein; Provisional 99.39
KOG0510|consensus 929 99.38
PHA02989 494 ankyrin repeat protein; Provisional 99.38
PHA02876 682 ankyrin repeat protein; Provisional 99.37
KOG4158|consensus 598 99.36
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.35
PHA02917661 ankyrin-like protein; Provisional 99.35
PLN03192823 Voltage-dependent potassium channel; Provisional 99.35
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.34
KOG1710|consensus 396 99.31
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.31
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.3
PF1360630 Ank_3: Ankyrin repeat 99.29
KOG3087|consensus229 99.29
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.27
KOG0590|consensus 601 99.27
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.27
PHA02792631 ankyrin-like protein; Provisional 99.27
>KOG0195|consensus Back     alignment and domain information
Probab=100.00  E-value=2.5e-40  Score=242.73  Aligned_cols=234  Identities=64%  Similarity=1.052  Sum_probs=206.6

Q ss_pred             cCccCCCCCchHHHHHHHhCCHHHHHHHHHCCCCCCccCCCCCCHHHHHHHcCCHhHHHHHHhhcCCcccccccCCCCcc
Q psy12580          3 YVSVTDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLLAVQNNQDLTKINFKDQSWL   82 (239)
Q Consensus         3 ~v~~~~~~g~tpl~~a~~~~~~~~~~~ll~~g~~~~~~~~~g~t~l~~a~~~g~~~~v~~Ll~~~~~~~~~~~~~~~t~l   82 (239)
                      |.|+.|..|.+||||||+.|+..+++.|+.+|+.+|..+....||||+|+.+||.++|+.|+ +..+|+|..|..|.||+
T Consensus        26 dln~gddhgfsplhwaakegh~aivemll~rgarvn~tnmgddtplhlaaahghrdivqkll-~~kadvnavnehgntpl  104 (448)
T KOG0195|consen   26 DLNVGDDHGFSPLHWAAKEGHVAIVEMLLSRGARVNSTNMGDDTPLHLAAAHGHRDIVQKLL-SRKADVNAVNEHGNTPL  104 (448)
T ss_pred             ccccccccCcchhhhhhhcccHHHHHHHHhcccccccccCCCCcchhhhhhcccHHHHHHHH-HHhcccchhhccCCCch
Confidence            67899999999999999999999999999999999999999999999999999999998884 46777788877777777


Q ss_pred             ccc------------------------------------------------------------------cccCccccccc
Q psy12580         83 GLK------------------------------------------------------------------TRSRDATLSRH   96 (239)
Q Consensus        83 ~~a------------------------------------------------------------------~~~~~~~~~~~   96 (239)
                      ++|                                                                  ++.++.+++++
T Consensus       105 hyacfwgydqiaedli~~ga~v~icnk~g~tpldkakp~l~~~l~e~aek~gq~~nripfkdt~wkgtktr~rdatlsr~  184 (448)
T KOG0195|consen  105 HYACFWGYDQIAEDLISCGAAVNICNKKGMTPLDKAKPMLKNTLLEIAEKHGQSPNRIPFKDTTWKGTKTRTRDATLSRY  184 (448)
T ss_pred             hhhhhhcHHHHHHHHHhccceeeecccCCCCchhhhchHHHHHHHHHHHHhCCCCCcccccccccccccccccccccccc
Confidence            753                                                                  22333445666


Q ss_pred             cCCCCCCCcccccccCCCCCCceeeccCCCceeeeeeeeccCCchHHHHHHHHHhHhhhcCCCceeeeeeeeeCCCceEE
Q psy12580         97 KGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDLVV  176 (239)
Q Consensus        97 ~~~~~~~~~~~~~ig~g~~g~v~~~~~~~~~~~vk~~~~~~~~~~~~~~~~~e~~~l~~l~h~~iv~l~~~~~~~~~~~l  176 (239)
                      .+++..++++..++.+...|..|+|+|.+..+++|++..+..++...+.|..|...++-..||||+.++|.|..+..+.+
T Consensus       185 ~gid~~~lnl~tkl~e~hsgelwrgrwqgndivakil~vr~~t~risrdfneefp~lrifshpnilpvlgacnsppnlv~  264 (448)
T KOG0195|consen  185 TGIDVSSLNLITKLAESHSGELWRGRWQGNDIVAKILNVREVTARISRDFNEEFPALRIFSHPNILPVLGACNSPPNLVI  264 (448)
T ss_pred             cCcchhhhhhhhhhccCCCcccccccccCcchhhhhhhhhhcchhhcchhhhhCcceeeecCCchhhhhhhccCCCCceE
Confidence            77888889999999999999999999999999999999998888888999999999999999999999999999999999


Q ss_pred             EEeeCCCCCHHHHhhcCCCcccCHHHHHHHHHHHHHHhhhhhcCCCCcccCCCCCccceee
Q psy12580        177 ISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVY  237 (239)
Q Consensus       177 v~e~~~~gsL~~~l~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~ivHrdikp~Nill~  237 (239)
                      +..||+.|||+.++..+.+-..+..++.+++.++++|+.|||+..+.|.---|.+..++||
T Consensus       265 isq~mp~gslynvlhe~t~vvvd~sqav~faldiargmaflhslep~ipr~~lns~hvmid  325 (448)
T KOG0195|consen  265 ISQYMPFGSLYNVLHEQTSVVVDHSQAVRFALDIARGMAFLHSLEPMIPRFYLNSKHVMID  325 (448)
T ss_pred             eeeeccchHHHHHHhcCccEEEecchHHHHHHHHHhhHHHHhhcchhhhhhhcccceEEec
Confidence            9999999999999999887778999999999999999999999886555556777777776



>KOG0595|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3kmw_A 271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 3e-44
3kmu_A 271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 2e-41
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 8e-21
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 9e-21
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-16
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-16
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-13
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-13
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-12
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-11
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 6e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-10
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-10
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-09
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 1e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-09
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-09
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-09
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-09
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-09
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 9e-09
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 9e-09
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-08
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-08
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-08
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-08
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-08
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-08
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 3e-08
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 3e-08
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 3e-08
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-08
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-08
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-08
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 3e-08
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 4e-08
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 4e-08
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 4e-08
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 4e-08
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 4e-08
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 4e-08
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-08
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 4e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-08
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 5e-08
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 5e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-08
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-08
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 6e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-08
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 6e-08
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 6e-08
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 6e-08
4h58_A 275 Braf In Complex With Compound 3 Length = 275 6e-08
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 7e-08
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 7e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-08
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 9e-08
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-07
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-07
1uoh_A226 Human Gankyrin Length = 226 1e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-07
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-07
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 1e-07
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 1e-07
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-07
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-07
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 4e-07
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 4e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-07
3mtf_A 301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 1e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-06
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 1e-06
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-06
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-06
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 2e-06
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 2e-06
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 2e-06
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 2e-06
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 3e-06
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 3e-06
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 3e-06
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-06
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-06
2p0c_A 313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 3e-06
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-06
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 3e-06
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-06
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 3e-06
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-06
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 4e-06
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 4e-06
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 4e-06
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 4e-06
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-06
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 4e-06
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-06
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 4e-06
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 4e-06
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 4e-06
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-06
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-06
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-06
3h9r_A 330 Crystal Structure Of The Kinase Domain Of Type I Ac 6e-06
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 6e-06
4dym_A 301 Crystal Structure Of The Acvr1 Kinase Domain In Com 6e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 7e-06
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 8e-06
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 8e-06
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 8e-06
3sxr_A 268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 9e-06
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 9e-06
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-06
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 1e-05
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 1e-05
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 1e-05
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-05
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 1e-05
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-05
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-05
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-05
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-05
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-05
1ycs_B239 P53-53bp2 Complex Length = 239 2e-05
3a4o_X 286 Lyn Kinase Domain Length = 286 2e-05
3my0_A 305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 2e-05
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-05
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-05
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 4e-05
4hzr_A 277 Crystal Structure Of Ack1 Kinase Domain Length = 27 4e-05
3eqp_B 276 Crystal Structure Of Ack1 With Compound T95 Length 4e-05
4id7_A 273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 4e-05
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 4e-05
1u46_A 291 Crystal Structure Of The Unphosphorylated Kinase Do 4e-05
1u54_A 291 Crystal Structures Of The Phosphorylated And Unphos 4e-05
4ewh_B 275 Co-Crystal Structure Of Ack1 With Inhibitor Length 4e-05
3nyx_A 302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 4e-05
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 5e-05
2wot_A 306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 5e-05
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 5e-05
1py5_A 326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 6e-05
3tzm_A 309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 6e-05
1rw8_A 301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 6e-05
1vjy_A 303 Crystal Structure Of A Naphthyridine Inhibitor Of H 6e-05
1b6c_B 342 Crystal Structure Of The Cytoplasmic Domain Of The 7e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 7e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-05
1byg_A 278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 8e-05
2og8_A 265 Crystal Structure Of Aminoquinazoline 36 Bound To L 8e-05
1ad5_A 438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 8e-05
3d7u_A 263 Structural Basis For The Recognition Of C-Src By It 8e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 8e-05
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 8e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 8e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 9e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 9e-05
3mpm_A 267 Lck Complexed With A Pyrazolopyrimidine Length = 26 9e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 9e-05
3nz0_A 302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 9e-05
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 9e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 9e-05
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 9e-05
1k9a_A 450 Crystal Structure Analysis Of Full-Length Carboxyl- 1e-04
3bym_A 272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-04
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-04
3lck_A 271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-04
3bys_A 277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-04
3d7t_A 269 Structural Basis For The Recognition Of C-Src By It 1e-04
4e20_A 290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
2of2_A 271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-04
4e1z_A 291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
2hk5_A 270 Hck Kinase In Complex With Lck Targetted Inhibitor 1e-04
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-04
2pl0_A 289 Lck Bound To Imatinib Length = 289 1e-04
2ofu_A 273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-04
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-04
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 1e-04
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 1e-04
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 1e-04
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-04
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 1e-04
3dtc_A 271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-04
2j0k_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 1e-04
3gu8_A 295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-04
2j0j_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-04
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-04
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 2e-04
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-04
2jkk_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-04
2xzs_A 312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-04
2w4k_A 302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 3e-04
2j0l_A 276 Crystal Structure Of A The Active Conformation Of T 3e-04
2yak_A 285 Structure Of Death-Associated Protein Kinase 1 (Dap 3e-04
3dfc_B 295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 3e-04
2ivt_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-04
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 3e-04
1p4f_A 293 Death Associated Protein Kinase Catalytic Domain Wi 3e-04
3gu4_A 295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 3e-04
2ivs_A 314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 3e-04
3f5u_A 295 Crystal Structure Of The Death Associated Protein K 3e-04
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 3e-04
1wvw_A 278 Crystal Structures Of Kinase Domain Of Dap Kinase I 3e-04
2w4j_A 277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 3e-04
1ig1_A 294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 3e-04
2jkm_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-04
4ebw_A 304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 4e-04
1mp8_A 281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 4e-04
2ivv_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 4e-04
2j0m_B 276 Crystal Structure A Two-Chain Complex Between The F 5e-04
2etm_A 281 Crystal Structure Of Focal Adhesion Kinase Domain C 5e-04
3pxk_A 282 Focal Adhesion Kinase Catalytic Domain In Complex W 5e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 6e-04
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 7e-04
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 7e-04
4f0f_A 287 Crystal Structure Of The Roco4 Kinase Domain Bound 7e-04
4h1j_A 293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 8e-04
3fzo_A 277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 9e-04
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure

Iteration: 1

Score = 174 bits (442), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 2/146 (1%) Query: 93 LSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPK 152 +++H GI L+ TK++ +G+ W+GRWQ NDIV K+L VR+ + R SRDFNEE P+ Sbjct: 1 MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR 60 Query: 153 LRIFSHPNVLPVIGCVNSP--PDLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDV 210 LRIFSHPNVLPV+G SP P +I+ +M +GSLY +LHEG VVD +QA++FA+D+ Sbjct: 61 LRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDM 120 Query: 211 ARGMAFLHSLERIIPQYQLNSRHVMV 236 ARGMAFLH+LE +IP++ LNSR VM+ Sbjct: 121 ARGMAFLHTLEPLIPRHALNSRSVMI 146
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 4e-63
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 8e-31
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 7e-28
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-27
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-27
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-11
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 6e-27
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 5e-26
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-06
3q4u_A 301 Activin receptor type-1; structural genomics conso 8e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-07
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-19
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 4e-22
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 5e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-20
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-20
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-19
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-08
3soc_A 322 Activin receptor type-2A; structural genomics cons 9e-20
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
2etb_A256 Transient receptor potential cation channel subfam 4e-19
2etb_A256 Transient receptor potential cation channel subfam 2e-16
2etb_A256 Transient receptor potential cation channel subfam 7e-11
2etb_A256 Transient receptor potential cation channel subfam 2e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-06
2pnn_A273 Transient receptor potential cation channel subfa 7e-19
2pnn_A273 Transient receptor potential cation channel subfa 3e-14
2pnn_A273 Transient receptor potential cation channel subfa 7e-12
2pnn_A273 Transient receptor potential cation channel subfa 2e-11
2pnn_A273 Transient receptor potential cation channel subfa 3e-11
2pnn_A273 Transient receptor potential cation channel subfa 7e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-13
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-13
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-17
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 4e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-10
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 2e-16
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-16
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-16
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 3e-16
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-16
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-16
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-15
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-15
2rfa_A232 Transient receptor potential cation channel subfa 2e-15
2rfa_A232 Transient receptor potential cation channel subfa 3e-15
2rfa_A232 Transient receptor potential cation channel subfa 4e-15
2rfa_A232 Transient receptor potential cation channel subfa 1e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-08
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-15
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-15
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 6e-15
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 6e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-10
3pls_A 298 Macrophage-stimulating protein receptor; protein k 1e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-05
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-14
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 3e-14
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-14
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-13
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-13
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-13
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-13
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-13
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-13
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-13
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-13
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 5e-13
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 5e-13
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 7e-13
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 7e-13
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 8e-13
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-12
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 3e-12
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-12
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-10
4aoj_A 329 High affinity nerve growth factor receptor; transf 3e-11
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-11
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 3e-11
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-11
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 6e-11
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 6e-11
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 4e-10
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 6e-10
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 1e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-09
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 6e-09
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 7e-09
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 8e-09
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 2e-08
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 5e-08
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 5e-08
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-07
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 5e-06
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 2e-05
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 5e-05
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-05
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 8e-05
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-04
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-04
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
 Score =  197 bits (503), Expect = 4e-63
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 2/146 (1%)

Query: 93  LSRHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPK 152
           +++H GI    L+  TK++   +G+ W+GRWQ NDIV K+L VR+ + R SRDFNEE P+
Sbjct: 1   MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR 60

Query: 153 LRIFSHPNVLPVIGCVNSPP--DLVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDV 210
           LRIFSHPNVLPV+G   SPP     +I+ +M +GSLY +LHEG   VVD +QA++FA+D+
Sbjct: 61  LRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDM 120

Query: 211 ARGMAFLHSLERIIPQYQLNSRHVMV 236
           ARGMAFLH+LE +IP++ LNSR VM+
Sbjct: 121 ARGMAFLHTLEPLIPRHALNSRSVMI 146


>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4aoj_A 329 High affinity nerve growth factor receptor; transf 100.0
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 100.0
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 100.0
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.98
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.98
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.97
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.97
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.97
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.97
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.96
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.96
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.96
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.95
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.95
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.95
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.95
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.95
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.95
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.95
3uqc_A 286 Probable conserved transmembrane protein; structur 99.95
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.95
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.95
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.95
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.95
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.95
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.95
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.95
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.95
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.95
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.95
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.95
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.95
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.95
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.95
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.95
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.95
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.95
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.95
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.95
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.95
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.95
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.95
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.95
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.95
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.95
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.95
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.95
3niz_A 311 Rhodanese family protein; structural genomics, str 99.95
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.95
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.95
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.95
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.95
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.95
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.95
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.95
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.94
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.94
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.94
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.94
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.94
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.94
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.94
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.94
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.94
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.94
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.94
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.94
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.94
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.94
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.94
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.94
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.94
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.94
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.94
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.94
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.94
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.94
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.94
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.94
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.94
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.94
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.94
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.94
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.94
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.94
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.94
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.94
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.94
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.94
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.94
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.94
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.94
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.94
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.94
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.94
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.94
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.94
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.94
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.94
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.94
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.94
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.94
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.94
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.94
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.94
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.94
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.94
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.94
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.94
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.94
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.94
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.94
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.94
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.94
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.94
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.94
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.94
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.94
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.94
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.94
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.94
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.94
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.94
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
3bhy_A 283 Death-associated protein kinase 3; death associate 99.93
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.93
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.93
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.93
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.93
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.93
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.93
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.93
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.93
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.93
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.93
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.93
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.93
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.93
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.93
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.93
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.93
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.93
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.93
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.93
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.93
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.93
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.93
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.93
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.93
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.93
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.93
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.93
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.93
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.93
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.93
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.93
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.93
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.93
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.93
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.93
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.93
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.93
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.93
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.93
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.93
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.93
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.93
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.93
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.93
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.93
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.93
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.93
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.93
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.93
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.93
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.93
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.93
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.92
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.92
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.92
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.92
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.92
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.92
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.92
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.92
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.92
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.92
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.92
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.92
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.92
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.92
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.92
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.92
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.92
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.92
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.92
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.92
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.92
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.92
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.92
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.92
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.92
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.92
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.92
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.92
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.92
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.92
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.92
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.91
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.91
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.91
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.91
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.91
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.91
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.91
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.91
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.91
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.91
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.91
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.91
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.9
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.9
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.9
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.9
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.9
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.9
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.9
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.9
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.9
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.9
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.9
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.9
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.89
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.89
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.86
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.85
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.85
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.83
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.8
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.78
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.78
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.77
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.76
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.76
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.76
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.75
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.75
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.75
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.75
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.75
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.74
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.74
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.73
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.73
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.73
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.73
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.73
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.73
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.72
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.72
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.72
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.72
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.72
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.72
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.72
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.72
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.71
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.71
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.71
3hra_A201 Ankyrin repeat family protein; structural protein; 99.71
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.71
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.71
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.71
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.7
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.7
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.7
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.7
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.7
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.7
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.69
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.68
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.68
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.68
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.67
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.67
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.67
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.67
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.66
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.66
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.66
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.66
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.66
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.66
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.66
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.66
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.66
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.65
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.65
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.65
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.65
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.65
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.65
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.64
2etb_A256 Transient receptor potential cation channel subfam 99.64
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.64
2rfa_A232 Transient receptor potential cation channel subfa 99.64
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.64
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.64
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.64
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.64
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.64
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.64
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.64
2rfa_A232 Transient receptor potential cation channel subfa 99.64
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.63
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.63
2etb_A256 Transient receptor potential cation channel subfam 99.63
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.63
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.63
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.63
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.63
3hra_A201 Ankyrin repeat family protein; structural protein; 99.62
2pnn_A273 Transient receptor potential cation channel subfa 99.62
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.62
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.62
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.62
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.62
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.62
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.61
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.61
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.61
2pnn_A273 Transient receptor potential cation channel subfa 99.61
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.6
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.6
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.58
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.58
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.58
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.58
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.57
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.56
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.56
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.51
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.5
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.47
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.39
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 99.37
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.34
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 99.2
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.18
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 99.07
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 98.7
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.59
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 98.52
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.43
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.22
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.21
3ats_A 357 Putative uncharacterized protein; hypothetical pro 97.93
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.6
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.53
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 97.5
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.19
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 96.89
3csv_A 333 Aminoglycoside phosphotransferase; YP_614837.1, ph 96.78
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 96.66
1zyl_A 328 Hypothetical protein YIHE; putative protein kinase 96.21
2ppq_A 322 HSK, HK, homoserine kinase; structural genomics, M 96.04
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 95.62
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 94.46
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 89.17
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 84.24
3mes_A 424 Choline kinase; malaria, structural genomics, stru 82.38
3i1a_A 339 Spectinomycin phosphotransferase; protein kinase, 82.24
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.5e-36  Score=236.21  Aligned_cols=138  Identities=29%  Similarity=0.487  Sum_probs=124.1

Q ss_pred             cccCCCCCCCcccccccCCCCCCceeeccCCCceeeeeeeeccCCchHHHHHHHHHhHhhhcCCCceeeeeeeeeCCCce
Q psy12580         95 RHKGISLNDLSLHTKISSGPNGDTWRGRWQKNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPDL  174 (239)
Q Consensus        95 ~~~~~~~~~~~~~~~ig~g~~g~v~~~~~~~~~~~vk~~~~~~~~~~~~~~~~~e~~~l~~l~h~~iv~l~~~~~~~~~~  174 (239)
                      ..++++.+++.+.+.||+|+||.||+|.+++ .+++|++..........+.|.+|+.+|++++|||||+++|++.. +.+
T Consensus        29 ~~Wei~~~~l~l~~~iG~G~fG~Vy~~~~~~-~vAvK~~~~~~~~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~-~~~  106 (307)
T 3omv_A           29 YYWEIEASEVMLSTRIGSGSFGTVYKGKWHG-DVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTK-DNL  106 (307)
T ss_dssp             CCCBCCTTSCCEEEECCCCSSSEEEEEESSS-EEEEEECCCSSCCHHHHHHHHHHHHHHTTCCCTTBCCEEEEECS-SSC
T ss_pred             cCcEEcHHHeEEeeEEeeCCCcEEEEEEECC-cEEEEEEEecCCCHHHHHHHHHHHHHHHhCCCCCEeeEEEEEEC-CeE
Confidence            4567889999999999999999999999865 58899987666666667889999999999999999999998865 568


Q ss_pred             EEEEeeCCCCCHHHHhhcCCCcccCHHHHHHHHHHHHHHhhhhhcCCCCcccCCCCCccceee
Q psy12580        175 VVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVY  237 (239)
Q Consensus       175 ~lv~e~~~~gsL~~~l~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~ivHrdikp~Nill~  237 (239)
                      +||||||++|||.++|....+ .+++.++..|+.||++||+|||+.+  ||||||||+|||||
T Consensus       107 ~iVmEy~~gGsL~~~l~~~~~-~l~~~~~~~i~~qia~gL~yLH~~~--IiHRDlKp~NILl~  166 (307)
T 3omv_A          107 AIVTQWCEGSSLYKHLHVQET-KFQMFQLIDIARQTAQGMDYLHAKN--IIHRDMKSNNIFLH  166 (307)
T ss_dssp             EEEEECCSSCBHHHHHHTSCC-CCCHHHHHHHHHHHHHHHHHHHHTT--CBCSCCCSSSEEEE
T ss_pred             EEEEEcCCCCCHHHHHhhcCC-CCCHHHHHHHHHHHHHHHHHHHHCC--ccCCccCHHHEEEC
Confidence            999999999999999976542 5999999999999999999999999  99999999999997



>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 239
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-17
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-16
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-14
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-14
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 6e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.003
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-13
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-13
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-08
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 9e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-12
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-12
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-12
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-12
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-11
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-11
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 4e-11
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-11
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 5e-11
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-11
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-11
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-10
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-10
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-10
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-10
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 8e-10
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-10
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-09
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-09
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-04
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-09
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-09
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-04
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-08
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-08
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-08
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-08
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 9e-08
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-07
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-07
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-07
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 8e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-04
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-06
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-05
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-05
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-05
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-05
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-05
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.003
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.004
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Lin-12
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 77.9 bits (190), Expect = 1e-17
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 7   TDDHGFSPLHWACKEGHLKLVELLLQRGARVNATNRGDDTPLHLAAAHGHLDIVRLL 63
            D+ G +P+  A +EG +++V  L+Q+GA V A +  D T   LA A+ H +IV + 
Sbjct: 217 QDEDGKTPIMLAAQEGRIEVVMYLIQQGASVEAVDATDHTARQLAQANNHHNIVDIF 273


>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 100.0
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.98
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.98
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.98
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.98
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.98
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.98
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.98
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.98
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.98
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.97
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.97
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.97
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.97
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.97
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.97
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.97
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.97
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.97
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.97
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.97
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.97
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.97
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.97
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.96
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.96
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.96
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.96
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.96
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.96
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.96
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.96
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.95
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.95
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.95
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.95
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.94
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.94
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.87
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.76
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.75
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.71
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.7
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.66
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.66
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.65
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.65
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.63
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.62
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.62
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.62
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.6
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.6
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.58
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.58
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.57
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.56
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.54
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.53
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.52
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.5
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.5
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.49
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.44
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.44
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.43
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.41
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.36
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.35
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.25
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.35
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.78
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.43
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 95.21
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 95.06
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=4.7e-35  Score=225.19  Aligned_cols=137  Identities=21%  Similarity=0.438  Sum_probs=122.6

Q ss_pred             ccCCCCCCCcccccccCCCCCCceeeccC--CCceeeeeeeeccCCchHHHHHHHHHhHhhhcCCCceeeeeeeeeCCCc
Q psy12580         96 HKGISLNDLSLHTKISSGPNGDTWRGRWQ--KNDIVAKILAVRNCTPRVSRDFNEEFPKLRIFSHPNVLPVIGCVNSPPD  173 (239)
Q Consensus        96 ~~~~~~~~~~~~~~ig~g~~g~v~~~~~~--~~~~~vk~~~~~~~~~~~~~~~~~e~~~l~~l~h~~iv~l~~~~~~~~~  173 (239)
                      .++++.++|++.+.||+|+||.||+|.+.  +..+|+|++.....   ..+.+.+|+.+|++++||||+++++++..++.
T Consensus        11 ~wei~~~~~~~~~~iG~G~fg~Vy~a~~~~~~~~vAvK~i~~~~~---~~~~~~~E~~il~~l~HpnIv~~~~~~~~~~~   87 (287)
T d1opja_          11 KWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTM---EVEEFLKEAAVMKEIKHPNLVQLLGVCTREPP   87 (287)
T ss_dssp             TTBCCGGGEEEEEETTTTTTSSEEEEEEGGGTEEEEEEECCTTCS---CHHHHHHHHHHHHHCCCTTBCCEEEEECSSSS
T ss_pred             ccEecHHHeEEeeEEeeCCCeEEEEEEECCCCeEEEEEEECCccc---hHHHHHHHHHHHHhCCCCCEecCCccEeeCCe
Confidence            45678889999999999999999999884  55688888754322   34678999999999999999999999999999


Q ss_pred             eEEEEeeCCCCCHHHHhhcCCCcccCHHHHHHHHHHHHHHhhhhhcCCCCcccCCCCCccceee
Q psy12580        174 LVVISQYMAWGSLYALLHEGAGIVVDFAQALRFAVDVARGMAFLHSLERIIPQYQLNSRHVMVY  237 (239)
Q Consensus       174 ~~lv~e~~~~gsL~~~l~~~~~~~~~~~~~~~~~~~i~~~l~~lH~~~~~ivHrdikp~Nill~  237 (239)
                      .++|||||++|+|.+++.......+++..+..++.||++||+|||+.+  ||||||||+|||||
T Consensus        88 ~~iv~E~~~~g~l~~~l~~~~~~~~~~~~~~~i~~qi~~gL~yLH~~~--iiHrDlKp~NILl~  149 (287)
T d1opja_          88 FYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKN--FIHRDLAARNCLVG  149 (287)
T ss_dssp             CEEEEECCTTCBHHHHHHHSCTTTSCHHHHHHHHHHHHHHHHHHHHTT--CCCSCCSGGGEEEC
T ss_pred             eEEEeecccCcchHHHhhhccccchHHHHHHHHHHHHHHHHHHHHHCC--cccCccccCeEEEC
Confidence            999999999999999998765557999999999999999999999999  99999999999997



>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure