Diaphorina citri psyllid: psy12584


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKEFYLHQFGKNQADFNFNNPQVVEYF
cEEEEEccccccccccHHHHHHccccccccccEEEcccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccHHHHHcc
IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKEFYLHQFGKNQADFNFNNPQVVE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKEFYLHQFGKNQADFNFNNPQVVEYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046352 [BP]disaccharide catabolic processprobableGO:0044275, GO:0044238, GO:1901575, GO:0044262, GO:0071704, GO:0005984, GO:0009987, GO:0009311, GO:0009313, GO:0016052, GO:0008150, GO:0044237, GO:0008152, GO:0044723, GO:0005975, GO:0009056, GO:0044724
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032450 [MF]maltose alpha-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004553, GO:0004558
GO:0004575 [MF]sucrose alpha-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004564, GO:0004553, GO:0004558

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UOK, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL