Psyllid ID: psy12584
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| 242013191 | 630 | Neutral and basic amino acid transport p | 0.978 | 0.146 | 0.532 | 3e-24 | |
| 215259593 | 584 | salivary alpha-glucosidase [Culex tarsal | 0.957 | 0.154 | 0.582 | 9e-24 | |
| 383863643 | 615 | PREDICTED: maltase 1-like isoform 2 [Meg | 0.978 | 0.149 | 0.537 | 2e-23 | |
| 383863641 | 613 | PREDICTED: maltase 1-like isoform 1 [Meg | 0.978 | 0.150 | 0.537 | 2e-23 | |
| 170062220 | 584 | alpha-glucosidase [Culex quinquefasciatu | 0.968 | 0.155 | 0.543 | 2e-22 | |
| 345490783 | 641 | PREDICTED: maltase 1-like isoform 2 [Nas | 0.989 | 0.145 | 0.537 | 8e-22 | |
| 345490781 | 639 | PREDICTED: maltase 1-like isoform 1 [Nas | 0.989 | 0.145 | 0.537 | 8e-22 | |
| 350427501 | 612 | PREDICTED: neutral and basic amino acid | 0.978 | 0.150 | 0.483 | 2e-21 | |
| 340714078 | 612 | PREDICTED: neutral and basic amino acid | 0.978 | 0.150 | 0.505 | 2e-21 | |
| 340714080 | 614 | PREDICTED: neutral and basic amino acid | 0.978 | 0.149 | 0.505 | 3e-21 |
| >gi|242013191|ref|XP_002427298.1| Neutral and basic amino acid transport protein rBAT, putative [Pediculus humanus corporis] gi|212511639|gb|EEB14560.1| Neutral and basic amino acid transport protein rBAT, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 115 bits (289), Expect = 3e-24, Method: Compositional matrix adjust.
Identities = 49/92 (53%), Positives = 69/92 (75%)
Query: 1 IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGS 60
I ++L+F P++SS KH +F S+ K+ PY +YY+WAP G +S+G+ + PNNWLS GGS
Sbjct: 224 ISIVLTFIPNHSSNKHIWFNNSIAKKAPYDDYYIWAPASGITSNGSKIPPNNWLSVNGGS 283
Query: 61 AWEWNAERKEFYLHQFGKNQADFNFNNPQVVE 92
AWEW ER+EFYLHQF +Q D N++NP V++
Sbjct: 284 AWEWVEERQEFYLHQFDIDQPDLNYHNPDVIK 315
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|215259593|gb|ACJ64288.1| salivary alpha-glucosidase [Culex tarsalis] | Back alignment and taxonomy information |
|---|
| >gi|383863643|ref|XP_003707289.1| PREDICTED: maltase 1-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383863641|ref|XP_003707288.1| PREDICTED: maltase 1-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|170062220|ref|XP_001866573.1| alpha-glucosidase [Culex quinquefasciatus] gi|167880215|gb|EDS43598.1| alpha-glucosidase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|345490783|ref|XP_003426457.1| PREDICTED: maltase 1-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345490781|ref|XP_001601349.2| PREDICTED: maltase 1-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350427501|ref|XP_003494778.1| PREDICTED: neutral and basic amino acid transport protein rBAT-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340714078|ref|XP_003395559.1| PREDICTED: neutral and basic amino acid transport protein rBAT-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340714080|ref|XP_003395560.1| PREDICTED: neutral and basic amino acid transport protein rBAT-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| FB|FBgn0033297 | 588 | Mal-A8 "Maltase A8" [Drosophil | 0.978 | 0.156 | 0.489 | 6.2e-20 | |
| FB|FBgn0033294 | 579 | Mal-A4 "Maltase A4" [Drosophil | 0.957 | 0.155 | 0.483 | 2.1e-19 | |
| FB|FBgn0033296 | 599 | Mal-A7 "Maltase A7" [Drosophil | 0.978 | 0.153 | 0.456 | 2.2e-19 | |
| FB|FBgn0050360 | 601 | Mal-A6 "Maltase A6" [Drosophil | 0.968 | 0.151 | 0.472 | 2.2e-19 | |
| FB|FBgn0032382 | 583 | Mal-B2 "Maltase B2" [Drosophil | 0.968 | 0.156 | 0.467 | 4.4e-19 | |
| FB|FBgn0032381 | 584 | Mal-B1 "Maltase B1" [Drosophil | 0.968 | 0.155 | 0.456 | 2.6e-18 | |
| FB|FBgn0002570 | 577 | Mal-A1 "Maltase A1" [Drosophil | 0.968 | 0.157 | 0.450 | 8.6e-18 | |
| FB|FBgn0050359 | 630 | Mal-A5 "Maltase A5" [Drosophil | 0.957 | 0.142 | 0.434 | 1.3e-17 | |
| UNIPROTKB|P28904 | 551 | treC [Escherichia coli K-12 (t | 0.882 | 0.150 | 0.439 | 2.1e-17 | |
| RGD|3709 | 683 | Slc3a1 "solute carrier family | 0.957 | 0.131 | 0.434 | 5.3e-17 |
| FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 245 (91.3 bits), Expect = 6.2e-20, P = 6.2e-20
Identities = 45/92 (48%), Positives = 60/92 (65%)
Query: 1 IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGS 60
+ ++L F P++SS + E+F KSVK+E+ Y +YYVW K S+ G P NWL GS
Sbjct: 121 LKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKREPPTNWLQYFRGS 180
Query: 61 AWEWNAERKEFYLHQFGKNQADFNFNNPQVVE 92
AWEWN R+++YLHQF Q D N+ NP VVE
Sbjct: 181 AWEWNEVRQQYYLHQFAVQQPDLNYRNPLVVE 212
|
|
| FB|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0050359 Mal-A5 "Maltase A5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28904 treC [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| RGD|3709 Slc3a1 "solute carrier family 3, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| cd11328 | 470 | cd11328, AmyAc_maltase, Alpha amylase catalytic do | 7e-41 | |
| cd11359 | 456 | cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom | 8e-31 | |
| cd11329 | 477 | cd11329, AmyAc_maltase-like, Alpha amylase catalyt | 1e-29 | |
| cd11333 | 428 | cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca | 9e-27 | |
| cd11330 | 472 | cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d | 1e-25 | |
| PRK10933 | 551 | PRK10933, PRK10933, trehalose-6-phosphate hydrolas | 1e-23 | |
| cd11331 | 450 | cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly | 8e-23 | |
| TIGR02403 | 543 | TIGR02403, trehalose_treC, alpha,alpha-phosphotreh | 2e-22 | |
| pfam00128 | 314 | pfam00128, Alpha-amylase, Alpha amylase, catalytic | 3e-15 | |
| cd11332 | 481 | cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti | 3e-13 | |
| cd11334 | 447 | cd11334, AmyAc_TreS, Alpha amylase catalytic domai | 3e-12 | |
| cd11316 | 403 | cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic | 3e-12 | |
| COG0366 | 505 | COG0366, AmyA, Glycosidases [Carbohydrate transpor | 9e-11 | |
| TIGR02456 | 539 | TIGR02456, treS_nterm, trehalose synthase | 2e-08 | |
| cd11348 | 429 | cd11348, AmyAc_2, Alpha amylase catalytic domain f | 9e-05 | |
| cd11343 | 445 | cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a | 0.001 |
| >gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins | Back alignment and domain information |
|---|
Score = 138 bits (351), Expect = 7e-41
Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
Query: 1 IHLLLSFSPDYSSTKHEFFQKSVKKEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGS 60
+ ++L F P++SS +HE+FQKSVK++EPY +YYVW K + +GT + PNNWLS GGS
Sbjct: 92 LKVILDFVPNHSSDEHEWFQKSVKRDEPYKDYYVWHDGKN-NDNGTRVPPNNWLSVFGGS 150
Query: 61 AWEWNAERKEFYLHQFGKNQADFNFNNPQVVE 92
AW WN ER+++YLHQF Q D N+ NP+VVE
Sbjct: 151 AWTWNEERQQYYLHQFAVKQPDLNYRNPKVVE 182
|
Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470 |
| >gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase | Back alignment and domain information |
|---|
| >gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| PRK13840 | 495 | sucrose phosphorylase; Provisional | 99.94 | |
| TIGR03852 | 470 | sucrose_gtfA sucrose phosphorylase. In the forward | 99.92 | |
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 99.9 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 99.9 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 99.82 | |
| TIGR02455 | 688 | TreS_stutzeri trehalose synthase, Pseudomonas stut | 99.82 | |
| KOG0471|consensus | 545 | 99.81 | ||
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 99.81 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 99.71 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 99.59 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 98.96 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 98.94 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 98.85 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 98.81 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 98.61 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 98.58 | |
| PLN02784 | 894 | alpha-amylase | 98.56 | |
| PLN02361 | 401 | alpha-amylase | 98.39 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 98.31 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 98.3 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 98.04 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 97.96 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 97.89 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 97.84 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 97.78 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 97.65 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 97.56 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 97.55 | |
| TIGR01531 | 1464 | glyc_debranch glycogen debranching enzymye. glycog | 97.5 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 97.48 | |
| COG3280 | 889 | TreY Maltooligosyl trehalose synthase [Carbohydrat | 97.47 | |
| PLN02960 | 897 | alpha-amylase | 97.43 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 97.34 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.28 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 97.09 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 97.0 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 96.95 | |
| PF14701 | 423 | hDGE_amylase: glucanotransferase domain of human g | 96.16 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 95.95 | |
| COG1523 | 697 | PulA Type II secretory pathway, pullulanase PulA a | 94.37 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 84.54 |
| >PRK13840 sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
Probab=99.94 E-value=7.8e-27 Score=176.71 Aligned_cols=90 Identities=14% Similarity=0.190 Sum_probs=73.3
Q ss_pred CEEEEeecCcccCCCCHHHHHhhhc--CCCCCCeEEeCCCCCCCCCCCCCCCCCCCcCCC---CC---cceeeCCCCcEE
Q psy12584 1 IHLLLSFSPDYSSTKHEFFQKSVKK--EEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEG---GS---AWEWNAERKEFY 72 (94)
Q Consensus 1 ikVilD~V~NHts~~h~WF~~a~~~--~~~~~d~f~~~~~~~~~~~~~~~~p~~~~s~~~---~~---~w~~~~~~~~~y 72 (94)
||||+|+|+||||++|||||+++++ +++|+|||+|.+.... .+ .++.++.+++. +. .|++++++.++|
T Consensus 78 iklmlDlV~NHtS~~h~WFqd~l~~~~~s~Y~D~fi~~d~~~~--~~--~~~~~~~~if~~~~g~~~~~~~~~~~~~~~~ 153 (495)
T PRK13840 78 HDIMADLIVNHMSAESPQFQDVLAKGEASEYWPMFLTKDKVFP--DG--ATEEDLAGIYRPRPGLPFTTYTLADGKTRLV 153 (495)
T ss_pred CeEEEEECCCcCCCCcHHHHHHHHhCCCCCccCeEEECCCCCc--CC--CCCcccccccCCCCCCcccceEecCCCceEE
Confidence 8999999999999999999999864 8999999999874321 01 24456666553 22 466777788999
Q ss_pred EecCCCCccccCCCCHHHHhhC
Q psy12584 73 LHQFGKNQADFNFNNPQVVEYF 94 (94)
Q Consensus 73 ~~~F~~~~pdLN~~np~V~~~~ 94 (94)
|++|.+.|||||++||+|+++|
T Consensus 154 w~tF~~~QpDLN~~NP~V~~~i 175 (495)
T PRK13840 154 WTTFTPQQIDIDVHSAAGWEYL 175 (495)
T ss_pred eccCCcccceeCCCCHHHHHHH
Confidence 9999999999999999999985
|
|
| >TIGR03852 sucrose_gtfA sucrose phosphorylase | Back alignment and domain information |
|---|
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type | Back alignment and domain information |
|---|
| >KOG0471|consensus | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01531 glyc_debranch glycogen debranching enzymye | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 94 | ||||
| 3axh_A | 589 | Crystal Structure Of Isomaltase In Complex With Iso | 8e-14 | ||
| 3a47_A | 589 | Crystal Structure Of Isomaltase From Saccharomyces | 8e-14 | ||
| 2pwe_A | 556 | Crystal Structure Of The Mutb E254q Mutant In Compl | 1e-10 | ||
| 1zja_A | 557 | Crystal Structure Of The Trehalulose Synthase Mutb | 1e-10 | ||
| 4gin_A | 584 | Crystal Structure Of The Mutb R284c Mutant From Cry | 1e-10 | ||
| 2pwf_A | 556 | Crystal Structure Of The Mutb D200a Mutant In Compl | 1e-10 | ||
| 2pwg_A | 556 | Crystal Structure Of The Trehalulose Synthase Mutb | 1e-10 | ||
| 4h2c_A | 557 | Trehalulose Synthase Mutb R284c Mutant Length = 557 | 1e-10 | ||
| 1m53_A | 570 | Crystal Structure Of Isomaltulose Synthase (Pali) F | 1e-10 | ||
| 1uok_A | 558 | Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas | 2e-10 | ||
| 4gi6_A | 557 | Crystal Structure Of The Mutb F164l Mutant In Compl | 4e-10 | ||
| 3gbd_A | 558 | Crystal Structure Of The Isomaltulose Synthase Smua | 5e-10 | ||
| 2ze0_A | 555 | Alpha-glucosidase Gsj Length = 555 | 3e-08 | ||
| 4aie_A | 549 | Structure Of Glucan-1,6-Alpha-Glucosidase From Lact | 6e-07 | ||
| 2zic_A | 543 | Crystal Structure Of Streptococcus Mutans Dextran G | 1e-05 | ||
| 2zid_A | 543 | Crystal Structure Of Dextran Glucosidase E236q Comp | 1e-05 |
| >pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 | Back alignment and structure |
|
| >pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 | Back alignment and structure |
| >pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 | Back alignment and structure |
| >pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 | Back alignment and structure |
| >pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 | Back alignment and structure |
| >pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 | Back alignment and structure |
| >pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 | Back alignment and structure |
| >pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 | Back alignment and structure |
| >pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 | Back alignment and structure |
| >pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 | Back alignment and structure |
| >pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 | Back alignment and structure |
| >pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 | Back alignment and structure |
| >pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 | Back alignment and structure |
| >pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 | Back alignment and structure |
| >pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 | Back alignment and structure |
| >pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 7e-29 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 9e-27 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 9e-27 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 1e-26 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 1e-26 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 6e-26 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 2e-24 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 1e-23 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 2e-17 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 1e-11 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 2e-16 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 5e-14 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 2e-11 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 2e-11 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 3e-10 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 4e-09 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 2e-07 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 1e-04 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 3e-04 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 8e-04 |
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 | Back alignment and structure |
|---|
Score = 106 bits (268), Expect = 7e-29
Identities = 34/80 (42%), Positives = 50/80 (62%), Gaps = 1/80 (1%)
Query: 12 SSTKHEFFQKSVK-KEEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKE 70
S++HE+F++S K P +++ W PPKGY ++G P+ PNNW S GGSAW ++ + +E
Sbjct: 113 CSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQE 172
Query: 71 FYLHQFGKNQADFNFNNPQV 90
FYL F Q D N+ N
Sbjct: 173 FYLRLFCSTQPDLNWENEDC 192
|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 99.92 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 99.92 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 99.92 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 99.92 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 99.9 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 99.9 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 99.89 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 99.84 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 99.83 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 99.83 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 99.83 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 99.82 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 99.8 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 99.79 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.76 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 99.72 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.7 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 99.69 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 99.63 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 99.63 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 99.62 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 99.61 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 99.47 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 99.42 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 99.33 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 99.31 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 99.3 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 99.3 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 99.23 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 99.22 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 99.19 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 99.19 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 99.18 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 99.16 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 99.16 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 99.15 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 99.15 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 99.14 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 99.1 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 99.08 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 99.06 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 99.05 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 99.04 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 98.98 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 98.88 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 98.85 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 98.78 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 98.78 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 98.74 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 98.73 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 98.67 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 98.65 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 98.53 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 98.44 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 98.42 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 98.38 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 98.27 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 98.16 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 98.06 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 98.06 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 98.03 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 97.98 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 97.78 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 97.64 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 97.5 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 97.2 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 96.06 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 86.4 |
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
Probab=99.92 E-value=1.1e-25 Score=171.85 Aligned_cols=94 Identities=35% Similarity=0.817 Sum_probs=81.1
Q ss_pred CEEEEeecCcccCCCCHHHHHhhhc-CCCCCCeEEeCCCCCCCCCCCCCCCCCCCcCCCCCcceeeCCCCcEEEecCCCC
Q psy12584 1 IHLLLSFSPDYSSTKHEFFQKSVKK-EEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKEFYLHQFGKN 79 (94)
Q Consensus 1 ikVilD~V~NHts~~h~WF~~a~~~-~~~~~d~f~~~~~~~~~~~~~~~~p~~~~s~~~~~~w~~~~~~~~~y~~~F~~~ 79 (94)
||||||+|+||||.+|+||++++++ +++|+|||+|.+.......|...+|++|.+.+++++|+++..+++||++.|...
T Consensus 102 i~VilD~V~NH~~~~~~wf~~~~~~~~~~y~d~y~~~~~~~~~~~g~~~~p~~~~~~f~g~~w~~~~~~~~~y~~~f~~~ 181 (589)
T 3aj7_A 102 MKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCST 181 (589)
T ss_dssp CEEEEEECCSBCCTTSHHHHHHTTCSSSTTGGGBCEECCSEECTTSCEECSSCBBCTTSSBSEEEETTTTEEEECSSSTT
T ss_pred CEEEEEecccccccchhHHHHHhcCCCCCCCCceeecCCcccccccCCCCCCcccccCCCccceecCCCCeEEECccCCC
Confidence 8999999999999999999999886 899999999987532111122246789999899999999999999999999999
Q ss_pred ccccCCCCHHHHhhC
Q psy12584 80 QADFNFNNPQVVEYF 94 (94)
Q Consensus 80 ~pdLN~~np~V~~~~ 94 (94)
|||||++||+||++|
T Consensus 182 ~pdLN~~np~Vr~~l 196 (589)
T 3aj7_A 182 QPDLNWENEDCRKAI 196 (589)
T ss_dssp CCBBCTTCHHHHHHH
T ss_pred CCccCCCCHHHHHHH
Confidence 999999999999975
|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 94 | ||||
| d1iv8a2 | 653 | c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase | 6e-12 | |
| d1gjwa2 | 572 | c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga | 8e-08 | |
| d1m53a2 | 478 | c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle | 8e-06 | |
| d1hx0a2 | 403 | c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s | 8e-04 |
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Maltooligosyl trehalose synthase species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]
Score = 57.6 bits (139), Expect = 6e-12
Identities = 10/90 (11%), Positives = 26/90 (28%), Gaps = 2/90 (2%)
Query: 1 IHLLLSFSPDYSSTKHE-FFQKSVKKEEPYTNYYVWAPPKGYSSDGT-PLAPNNWLSKEG 58
+ ++ P++ + + V K + YY + P+ + +
Sbjct: 80 LGIIQDIVPNHMAVNSLNWRLMDVLKMGKKSKYYTYFDFFPEDDKIRLPILGEDLDTVIS 139
Query: 59 GSAWEWNAERKEFYLHQFGKNQADFNFNNP 88
+ + E++L F N
Sbjct: 140 KGLLKIVKDGDEYFLEYFKWKLPLTEVGND 169
|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 99.79 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 99.76 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 99.71 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 99.7 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 99.61 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 99.59 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 99.56 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 99.56 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 99.54 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 99.53 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 99.38 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 99.34 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 99.33 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 99.33 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 99.27 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 99.23 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 99.22 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 99.13 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 99.11 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 99.09 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 99.08 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 99.08 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 99.06 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 99.04 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 99.02 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 98.98 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 98.96 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 98.9 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 98.9 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 98.71 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 98.68 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 98.53 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 98.25 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 94.98 |
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Isomaltulose synthase PalI species: Klebsiella sp., lx3 [TaxId: 576]
Probab=99.79 E-value=1e-19 Score=131.25 Aligned_cols=88 Identities=36% Similarity=0.740 Sum_probs=78.4
Q ss_pred CEEEEeecCcccCCCCHHHHHhhhc-CCCCCCeEEeCCCCCCCCCCCCCCCCCCCcCCCCCcceeeCCCCcEEEecCCCC
Q psy12584 1 IHLLLSFSPDYSSTKHEFFQKSVKK-EEPYTNYYVWAPPKGYSSDGTPLAPNNWLSKEGGSAWEWNAERKEFYLHQFGKN 79 (94)
Q Consensus 1 ikVilD~V~NHts~~h~WF~~a~~~-~~~~~d~f~~~~~~~~~~~~~~~~p~~~~s~~~~~~w~~~~~~~~~y~~~F~~~ 79 (94)
||||||+|+||||.+||||+.+... ..+|+++|.|.+.... .+|.++.+.+++..|.++...+++|+++|...
T Consensus 93 i~VilD~V~NH~~~~~~~f~~~~~~~~~~~~~~~~~~d~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 166 (478)
T d1m53a2 93 MRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDN------QPPNNYPSFFGGSAWQKDAKSGQYYLHYFARQ 166 (478)
T ss_dssp CEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCSSS------SCSSCCBCTTSSBSEEECTTTCCEEECSSCTT
T ss_pred CEEEeccccccccccCchhhhcccCCCCCccccccccCCCcC------CCCccccccCCCCccccccccCcccccCcCCC
Confidence 8999999999999999999999887 7999999999986432 36677878788888888888899999999999
Q ss_pred ccccCCCCHHHHhhC
Q psy12584 80 QADFNFNNPQVVEYF 94 (94)
Q Consensus 80 ~pdLN~~np~V~~~~ 94 (94)
+||||++||+|+++|
T Consensus 167 ~~dln~~~~~V~~~i 181 (478)
T d1m53a2 167 QPDLNWDNPKVREDL 181 (478)
T ss_dssp CCBBCTTSHHHHHHH
T ss_pred CCcccchhHHHHHHH
Confidence 999999999999874
|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|